KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512725
Entry
108512725         CDS       T04641                                 

Gene name
NCF2
Definition
(RefSeq) neutrophil cytosolic factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04670  Leukocyte transendothelial migration
rbb05020  Prion disease
rbb05140  Leishmaniasis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512725 (NCF2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108512725 (NCF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108512725 (NCF2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    108512725 (NCF2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108512725 (NCF2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108512725 (NCF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108512725 (NCF2)
Membrane trafficking [BR:rbb04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108512725 (NCF2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 TPR_1 TPR_2 TPR_8 PB1 TPR_12 TPR_16 TPR_17 TPR_9 Cohesin_load TPR_11
Other DBs
NCBI-GeneID: 108512725
NCBI-ProteinID: XP_017703590
UniProt: A0A2K6KBS5
LinkDB
Position
Un
AA seq 526 aa
MSLAEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMHTILKNMTEAEKAF
TKSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALTQLRGNQLIDYKILGLQFKLFA
CEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVDHDSFSGFAPLQPQAAEPPPRPKTPEIFRAL
EGEAHRVLFGFVPETQEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR
IHPQQQPQEESSPESDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKY
TVVMETQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDNMKDAWGLVKNY
CLTLWCENTVGDQGFPDEPKESKKADANKQTTDSQLKKGSQVEALFSYEATQPEDLEFQE
GDIILVLSKVNEEWLEGECKGKVGIFPKVFVEECATTDLESTRREV
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgtccctggcggaggccatcagcctctggaatgaaggggtgctggcagctgacaagaag
gactggaagggagccctggacgccttcagtgccgtccaggacccccactcccggatttgc
ttcaacattggctgcatgcacactatcctgaaaaacatgactgaagcagagaaggccttt
accaaaagcattaaccgagacaagcatttggcagtggcttacttccaacgagggatgctc
tactaccaaacagagaaatacgatttggctatcaaagaccttaaagaagccttgactcag
cttcgagggaaccagctgatagactataagatcctggggctccagttcaagctgtttgcc
tgtgaggtgttatataacattgctttcatgtatgccaagaaggaggaatggaaaaaagct
gaagaacagttagcattggccacgagcatgaagtctgagcccagacattccaaaatcgac
aaggccatggagtgtgtctggaagcagaagctgtacgagccagtggtgatccctgtgggc
aggctatttcgaccaaatgagagacaagtagctcagctggccaagaaggattacctaggc
aaggcgacggttgtggcgtctgtagtggatcatgacagtttctctgggtttgcccctctg
caaccacaggcagctgaacctccacccagaccgaaaaccccagagatcttcagggctctg
gaaggggaggctcaccgtgtgctgtttgggtttgtgcctgagacacaagaagagctccag
gtcatgccagggaacattgtctttgtcttgaagaagggcaatgataactgggccacggtc
atgttcaacgggcagaaggggcttgttccctgcaactaccttgaaccagttgagctgcgg
atccaccctcagcagcagccccaggaggaaagctctccggagtccgacatcccagctcct
cctagttccaaagcccctggaagaccccagttgtcaccaggtcagaaacaaaaagaagag
cctaaggaagtgaagctcagtgttcccatgccctacacactcaaggtgcactacaagtat
acggtagtcatggagactcagcctggactcccctacagtcaggtccgggacatggtgtct
aagaaactggagctccggctggaacacactaagctgagctatcggcctcgagacagcaat
gagctggtgcccctttcagaagacaacatgaaggatgcctggggcctggtgaaaaactac
tgtctgactctgtggtgtgagaacacagtgggtgaccaaggctttccagatgaacccaag
gaaagtaaaaaagctgatgctaataaacagacaacagattcgcagcttaagaaaggcagc
caagtggaggcactcttcagttatgaggctacccaaccagaggacctggagtttcaggaa
ggggatataatactggtgctatcaaaggtgaatgaagaatggctggaaggggagtgcaaa
gggaaggtgggcatttttcccaaagttttcgttgaagaatgtgcaactacagatttggaa
agcactcggagagaagtctag

DBGET integrated database retrieval system