Rhinopithecus bieti (black snub-nosed monkey): 108512973 Help Entry 108512973         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM beta chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512973  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512973  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512973    04612 Antigen processing and presentation     108512973    04658 Th1 and Th2 cell differentiation     108512973    04659 Th17 cell differentiation     108512973    04672 Intestinal immune network for IgA production     108512973  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512973    05322 Systemic lupus erythematosus     108512973    05323 Rheumatoid arthritis     108512973    05320 Autoimmune thyroid disease     108512973    05321 Inflammatory bowel disease     108512973    05330 Allograft rejection     108512973    05332 Graft-versus-host disease     108512973   09166 Cardiovascular disease    05416 Viral myocarditis     108512973   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512973   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512973    05152 Tuberculosis     108512973   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512973    05164 Influenza A     108512973    05168 Herpes simplex virus 1 infection     108512973    05169 Epstein-Barr virus infection     108512973   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512973    05140 Leishmaniasis     108512973  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512973 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512973   Exosomal proteins of epithelial cells    108512973   Exosomal proteins of breast milk    108512973 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 Ig_2 I-set C2-set_2 ig Motif Other DBs NCBI-GeneID:  108512973 NCBI-ProteinID:  XP_017704043 UniProt:  A0A2K6KVH0 LinkDB All DBs Position Un AA seq 263 aa AA seqDB search MIIFLPLLLGLSLGCTRAGGFVAHVESTCLLDDDGTAKDFTYCISFNKDLLTCWDPEENK MVPCEFGVLNRLANGISDYLNQQDTLMQRLRNGLQNCATHTQPFWGSLTHRTRPPSVQVA QTTPFNTREPVMLACYVWGFYPADVTITWMKNGNLVIPHSSGQKTAQPNGDWTYQTLSFL ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGLISW RRAGSSSYTPLPGSNYPEGRHIS NT seq 792 nt NT seq  +upstreamnt  +downstreamnt atgatcatattcctgccgctgctgctggggctcagcctgggctgcacaagagcaggtggc ttcgtggcccatgtggaaagcacctgtctactggatgatgatgggactgcaaaggatttc acatactgtatctccttcaacaaggatctgctgacctgctgggatccagaggagaacaag atggtcccttgtgaatttggggtgctgaatcgcttggccaatggcatctcagattacctc aaccaacaggacaccttgatgcagcgcttgcgcaatgggcttcagaattgtgccacacat acccagcccttctggggatcactgacccacaggacacggccaccatctgtgcaagtagcc caaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc tatccagcagatgtgaccatcacgtggatgaagaatgggaatcttgtcatccctcacagc agtggccagaagactgcccagcccaatggagactggacataccagaccctctccttttta gccctaaccccctcttacggggacacctacacctgtgtggtggagcacattggggctcct gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtttgatcagctgg cggagagctggctcctctagttacactcctcttcctgggtccaattatccagaaggacgg cacatttcctag

Rhinopithecus bieti (black snub-nosed monkey): 108512974 Help Entry 108512974         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM alpha chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512974  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512974  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512974    04612 Antigen processing and presentation     108512974    04658 Th1 and Th2 cell differentiation     108512974    04659 Th17 cell differentiation     108512974    04672 Intestinal immune network for IgA production     108512974  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512974    05322 Systemic lupus erythematosus     108512974    05323 Rheumatoid arthritis     108512974    05320 Autoimmune thyroid disease     108512974    05321 Inflammatory bowel disease     108512974    05330 Allograft rejection     108512974    05332 Graft-versus-host disease     108512974   09166 Cardiovascular disease    05416 Viral myocarditis     108512974   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512974   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512974    05152 Tuberculosis     108512974   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512974    05164 Influenza A     108512974    05168 Herpes simplex virus 1 infection     108512974    05169 Epstein-Barr virus infection     108512974   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512974    05140 Leishmaniasis     108512974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512974 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512974   Exosomal proteins of epithelial cells    108512974   Exosomal proteins of breast milk    108512974 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set SKG6 Ig_2 Motif Other DBs NCBI-GeneID:  108512974 NCBI-ProteinID:  XP_017704045 UniProt:  A0A2K6K9R8 LinkDB All DBs Position Un AA seq 261 aa AA seqDB search MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPVWRDDLQNHTFLHTVYCQDGSPSMGLS EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKAFCELMIQQVGPQLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVD GLSFQAFSYLNITPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atgggtcatgaacagaatcaaggagctgcgctgctccagatgctaccacttctgtggctg ctaccccactcctgggccgtcccagaagctcctactccagtgtggcgagatgacctgcaa aaccacacgttcctgcacacagtgtactgccaggatgggagtcccagtatgggactctct gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct cgcctgcctgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt gacaaagcgttctgcgagttgatgatccagcaagtagggccacaacttgatgggaaaatc ccggtgtccagagggtttcctatcgctgaggtgttcacgctgaagcccctggagtttggc aaacccaacacgttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac tggcagcatcattccgtccctgtggaaggatctgggcctacttttgtctcagctgtcgat ggactcagcttccaagccttttcttacttaaacatcacaccggaaccttctgacattttc tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccccag aacgcactaccctcagatctgctggagaatgtgctgtgtggcgtggcctttggtttgggt gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt gactga

Rhinopithecus bieti (black snub-nosed monkey): 108512982 Help Entry 108512982         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO beta chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512982  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512982  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512982    04612 Antigen processing and presentation     108512982    04658 Th1 and Th2 cell differentiation     108512982    04659 Th17 cell differentiation     108512982    04672 Intestinal immune network for IgA production     108512982  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512982    05322 Systemic lupus erythematosus     108512982    05323 Rheumatoid arthritis     108512982    05320 Autoimmune thyroid disease     108512982    05321 Inflammatory bowel disease     108512982    05330 Allograft rejection     108512982    05332 Graft-versus-host disease     108512982   09166 Cardiovascular disease    05416 Viral myocarditis     108512982   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512982   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512982    05152 Tuberculosis     108512982   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512982    05164 Influenza A     108512982    05168 Herpes simplex virus 1 infection     108512982    05169 Epstein-Barr virus infection     108512982   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512982    05140 Leishmaniasis     108512982  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512982 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512982   Exosomal proteins of epithelial cells    108512982   Exosomal proteins of breast milk    108512982 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig MHC_I C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  108512982 NCBI-ProteinID:  XP_017704053 UniProt:  A0A2K6M430 LinkDB All DBs Position Un AA seq 273 aa AA seqDB search MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSREAVDGVCRHNYRLGAPFTVGRK VQPEVTVYPERTALLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERAGVMSTGLIGNGDWT FQTVVILEMTPELGDVYTCLVHHSSLLSPVSVEWRVQSEYSWRKMLSGIAAFLLGLIFLL VGIVIQLRAQKGYVRTQMSGDEVSRAVLLPQPC NT seq 822 nt NT seq  +upstreamnt  +downstreamnt atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgaccagactggat tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgacgaagctgggg cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagagaggcc gtggatggggtctgtagacacaactacagactgggcgcacccttcactgtgggaagaaaa gtgcaaccagaggtgacagtgtacccagagaggaccgcactcctgcaccagcataatctg ctgcactgctctgtgacgggcttctatccaggggacatcaagatcaggtggttcctgaat gggcaggaggagagagctggggtcatgtccactggccttatcgggaatggagactggacc tttcagactgtggtgatactagaaatgactcctgaacttggagatgtctacacctgcctt gtccatcactccagcctgctgagccctgtttctgtggagtggagagttcagtctgaatat tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg gtgggaatcgtcatccagcttagggctcagaaaggatatgtgaggacacagatgtctggt gatgaggtctcaagagctgttctgctccctcagccatgctaa

Rhinopithecus bieti (black snub-nosed monkey): 108512983 Help Entry 108512983         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512983  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512983  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512983    04612 Antigen processing and presentation     108512983    04658 Th1 and Th2 cell differentiation     108512983    04659 Th17 cell differentiation     108512983    04672 Intestinal immune network for IgA production     108512983  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512983    05322 Systemic lupus erythematosus     108512983    05323 Rheumatoid arthritis     108512983    05320 Autoimmune thyroid disease     108512983    05321 Inflammatory bowel disease     108512983    05330 Allograft rejection     108512983    05332 Graft-versus-host disease     108512983   09166 Cardiovascular disease    05416 Viral myocarditis     108512983   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512983   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512983    05152 Tuberculosis     108512983   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512983    05164 Influenza A     108512983    05168 Herpes simplex virus 1 infection     108512983    05169 Epstein-Barr virus infection     108512983   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512983    05140 Leishmaniasis     108512983  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512983 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512983   Exosomal proteins of epithelial cells    108512983   Exosomal proteins of breast milk    108512983 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 MHC_I ig C2-set_2 Motif Other DBs NCBI-GeneID:  108512983 NCBI-ProteinID:  XP_017704054 UniProt:  A0A2K6KW97 LinkDB All DBs Position Un AA seq 261 aa AA seqDB search MPWKKALQIPGGLWAATVTLMLAMLSTPVTEGRDSPEDFVYQFKGMCYFTNGTEHVRLVA RHVYNREEYARFDSDVGVYRAVTPLGQSSAEYWNSQKEVLERKRAELDTVCRHNYQLELR TTLQRRVEPTVTISPSKTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETTGIVSTPLI RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL GMILLGLGLVIHHRSQKGLLH NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atgccttggaagaaggctttgcagatccccggaggcctttgggcagcaactgtgaccttg atgctggcgatgctaagcaccccagtgactgaaggcagagactctcccgaggatttcgtg taccagtttaaaggcatgtgctacttcaccaacgggacagagcacgtgcggttggtagcc agacacgtctataaccgcgaagagtacgcgcgcttcgacagcgatgtgggggtgtaccgg gcggtgacgccgctggggcagtctagcgccgagtactggaacagccagaaggaagtcctg gagaggaaacgggcggagttggacacggtgtgcagacacaactaccagttggagctccgc acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaagacagaggcc ctcaaccaccataacctgctagtctgctcggtgacagatttctatccaggccagatcaaa gtccggtggtttcggaatgaccaggaggagacaaccggcattgtgtccaccccccttatt aggaacggcgactggaccttccagatcctggtgatgctggaaatgactccccagcgggga gatgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggctttgtgctg gggatgatcttactcgggctgggccttgtcatccatcacaggagtcagaaagggctcctg cactga

Rhinopithecus bieti (black snub-nosed monkey): 108512984 Help Entry 108512984         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512984  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512984  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512984    04612 Antigen processing and presentation     108512984    04658 Th1 and Th2 cell differentiation     108512984    04659 Th17 cell differentiation     108512984    04672 Intestinal immune network for IgA production     108512984  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512984    05322 Systemic lupus erythematosus     108512984    05323 Rheumatoid arthritis     108512984    05320 Autoimmune thyroid disease     108512984    05321 Inflammatory bowel disease     108512984    05330 Allograft rejection     108512984    05332 Graft-versus-host disease     108512984   09166 Cardiovascular disease    05416 Viral myocarditis     108512984   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512984   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512984    05152 Tuberculosis     108512984   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512984    05164 Influenza A     108512984    05168 Herpes simplex virus 1 infection     108512984    05169 Epstein-Barr virus infection     108512984   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512984    05140 Leishmaniasis     108512984  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512984 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512984   Exosomal proteins of epithelial cells    108512984   Exosomal proteins of breast milk    108512984 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 SKG6 EF_assoc_2 Motif Other DBs NCBI-GeneID:  108512984 NCBI-ProteinID:  XP_017704055 UniProt:  A0A2K6KW15 LinkDB All DBs Position Un AA seq 254 aa AA seqDB search MILNKALMLGALALTTVMSPSGGEEIVADHVASYGVNLYQTYGLSGQYSHEFDGDEQFYV DLGRKETVWRLPVLSQFSFDAQFALTNIAVGKHNLNFLIKSSNSTAATNEVPEVTVFSKS PVTLGHPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLP SADEIYDCRVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVLIIR GLRSVGASRHQGPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atgatcttaaacaaagctctgatgctgggggccctcgccctgaccaccgtgatgagcccc agtggaggtgaagaaattgtggctgaccatgttgcctcttacggtgtaaacttgtaccag acttacggtctctctggccagtactcccatgaatttgacggagatgagcagttctacgtg gacctggggaggaaggagactgtctggcggttgcctgttctcagccaatttagtttcgac gcgcaatttgcactgacaaacattgctgtgggaaaacataacttgaacttcctgattaaa agctccaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaagtcg cccgtgacactgggtcaccccaacaccctcatctgtcttgtggacaacatctttcctcct gtggtgaacatcacatggttgagtaatgggcactcagtcacagaaggggtttctgagacc agcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctccct tctgctgatgagatttatgactgcagggtggagcactggggcctggacgagcctcttcta aaacactgggagccggagattccagcgcccatgtcagagctcacagagactgtggtctgc gccctggggttgtctgtgggcctcgtaggcattgtggtgggcactgtcttgatcatccga ggcctgcgttcagttggtgcttccagacaccaagggcccttgtga

Rhinopithecus bieti (black snub-nosed monkey): 108512985 Help Entry 108512985         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO alpha chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108512985  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108512985  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108512985    04612 Antigen processing and presentation     108512985    04658 Th1 and Th2 cell differentiation     108512985    04659 Th17 cell differentiation     108512985    04672 Intestinal immune network for IgA production     108512985  09160 Human Diseases   09163 Immune disease    05310 Asthma     108512985    05322 Systemic lupus erythematosus     108512985    05323 Rheumatoid arthritis     108512985    05320 Autoimmune thyroid disease     108512985    05321 Inflammatory bowel disease     108512985    05330 Allograft rejection     108512985    05332 Graft-versus-host disease     108512985   09166 Cardiovascular disease    05416 Viral myocarditis     108512985   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108512985   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108512985    05152 Tuberculosis     108512985   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108512985    05164 Influenza A     108512985    05168 Herpes simplex virus 1 infection     108512985    05169 Epstein-Barr virus infection     108512985   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108512985    05140 Leishmaniasis     108512985  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108512985 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108512985   Exosomal proteins of epithelial cells    108512985   Exosomal proteins of breast milk    108512985 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 C2-set_2 Motif Other DBs NCBI-GeneID:  108512985 NCBI-ProteinID:  XP_017704057 LinkDB All DBs Position Un AA seq 311 aa AA seqDB search MALRAGLVLGFHSLMTLLSPQEAGATKADHMGSYGPAFYQSYSTSGQFTHEFDGEQLFSV DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRTRAINVPPRVTVFPK SRVELGQPNILICLVDNIFPPVINITWLRNGQAVTEGVAQTSFYSQPDHLFRKFHYLPFV PSAKDIYDCQVEHWGLDAPLLRHWGTEPPPHAPSWPQVSFTLDSFPIPPIPSFLSQSSRC LFNHQMPWRPSSVPWAWPLAWWASSWAPSSSSWAHMCPVPPGNDPSERNDLWETPCRSSW ICDSSCVLSAL NT seq 936 nt NT seq  +upstreamnt  +downstreamnt atggccctcagagcagggctggtcctggggttccacagcctgatgaccctcctgagcccg caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag tcttacagcacctcgggccagttcacccatgaatttgatggggaacagctgttctctgtg gacctgaagaaaagtgaggctgtgtggcgtctgcctgagtttggcgactttgcccgcttt gacccgcagggtgggctggccggcatcgccgcgatcaaagcccatctggacatcctggtg gagcgctccaaccgcaccagagccatcaacgtgcctccacgggtgaccgtgttccccaag tctcgggtggagttgggccagcccaacatcctcatctgcctcgtggacaacatcttccca cctgtgatcaatatcacctggctgcgcaacggccaagctgtcactgagggagtggcccag accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg ccctcagccaaggacatctatgactgccaggtggagcactggggcctggatgcgccactc ctcaggcattggggtacggagccccctccccacgcaccctcctggccccaggtttccttt actctagattccttccctataccaccaattccttcctttctctcccagagctccaggtgc ctattcaaccaccagatgccatggagaccctcgtctgtgccctgggcctggccattggcc tggtgggcttcctcgtgggcaccatcctcatcatcatgggcacatatgtgtccagtgccc ccaggtaatgatccttctgagagaaatgacttgtgggagacaccctgcagatcctcgtgg atttgtgacagctcctgcgtgctcagtgccctttaa

Rhinopithecus bieti (black snub-nosed monkey): 108519881 Help Entry 108519881         CDS       T04641                                  Definition (RefSeq) mamu class II histocompatibility antigen, DR alpha chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108519881  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108519881  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108519881    04612 Antigen processing and presentation     108519881    04658 Th1 and Th2 cell differentiation     108519881    04659 Th17 cell differentiation     108519881    04672 Intestinal immune network for IgA production     108519881  09160 Human Diseases   09163 Immune disease    05310 Asthma     108519881    05322 Systemic lupus erythematosus     108519881    05323 Rheumatoid arthritis     108519881    05320 Autoimmune thyroid disease     108519881    05321 Inflammatory bowel disease     108519881    05330 Allograft rejection     108519881    05332 Graft-versus-host disease     108519881   09166 Cardiovascular disease    05416 Viral myocarditis     108519881   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108519881   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108519881    05152 Tuberculosis     108519881   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108519881    05164 Influenza A     108519881    05168 Herpes simplex virus 1 infection     108519881    05169 Epstein-Barr virus infection     108519881   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108519881    05140 Leishmaniasis     108519881  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108519881 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108519881   Exosomal proteins of epithelial cells    108519881   Exosomal proteins of breast milk    108519881 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Motif Other DBs NCBI-GeneID:  108519881 NCBI-ProteinID:  XP_017714644 UniProt:  A0A2K6KYL0 LinkDB All DBs Position Un AA seq 254 aa AA seqDB search MAVSGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNNTPITNVPPEVTVLTNS PVELGEPNVLICFIDKFSPPVVNVTWLQNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP STEDIYDCKVEHWGLDAPLLKHWEFDAPSPLPETKENVVCALGLIVGLVGIIVGTVFIIK GVRKSNAAERRGPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggccgtaagtggagtccccgtgctaggatttttcatcatagctgtgctgatgagcgct caggaatcatgggctatcaaagaagaacacgtgatcatccaggctgagttctatctgaac cctgaccaatcaggagagtttatgtttgactttgatggtgatgagattttccacgtggat atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag cgctccaacaatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc cctgtggaactgggagagcccaacgtcctcatctgtttcatcgacaagttctctccacca gtggtcaatgttacatggcttcaaaatggaaaacctgtcaccacaggagtgtcagagaca gtcttcctgcccagggaagaccaccttttccggaagttccactatctccccttcctgccc tcaactgaagacatttatgactgcaaggtggagcactggggcttggatgcgccgcttctc aagcactgggagtttgatgcaccaagccctctcccagagactaaagagaacgtggtgtgt gccctgggcctgattgtgggtctggtgggcatcattgttgggaccgtcttcatcatcaag ggtgtgcgcaaaagcaatgctgcagaacgcagggggcctctgtga

Rhinopithecus bieti (black snub-nosed monkey): 108519884 Help Entry 108519884         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DRB1-13 beta chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108519884  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108519884  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108519884    04612 Antigen processing and presentation     108519884    04658 Th1 and Th2 cell differentiation     108519884    04659 Th17 cell differentiation     108519884    04672 Intestinal immune network for IgA production     108519884  09160 Human Diseases   09163 Immune disease    05310 Asthma     108519884    05322 Systemic lupus erythematosus     108519884    05323 Rheumatoid arthritis     108519884    05320 Autoimmune thyroid disease     108519884    05321 Inflammatory bowel disease     108519884    05330 Allograft rejection     108519884    05332 Graft-versus-host disease     108519884   09166 Cardiovascular disease    05416 Viral myocarditis     108519884   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108519884   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108519884    05152 Tuberculosis     108519884   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108519884    05164 Influenza A     108519884    05168 Herpes simplex virus 1 infection     108519884    05169 Epstein-Barr virus infection     108519884   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108519884    05140 Leishmaniasis     108519884  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108519884 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108519884   Exosomal proteins of epithelial cells    108519884   Exosomal proteins of breast milk    108519884 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 DUF202 Motif Other DBs NCBI-GeneID:  108519884 NCBI-ProteinID:  XP_017714645 LinkDB All DBs Position Un AA seq 282 aa AA seqDB search MCSVLDSREWKMIHREMDCAEKKEEGTGQQRGLRNSPGMLENKTREYNASRFLEQAKSEC HFFNGTERVRFLDRYIHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAV DTYCRHNYGVFDSFTVQRRVQPRVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNG QEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGELYTCQVEHPSVTSPLTVEWRARSESA QSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGLLS NT seq 849 nt NT seq  +upstreamnt  +downstreamnt atgtgtagtgtgttagattccagggagtggaagatgatacatagggagatggattgtgcg gagaaaaaagaagagggcacaggccagcaaagggggctgagaaacagcccagggatgttg gagaataaaacaagagaatataatgcgtcacgtttcttggagcaggctaagtctgagtgt cacttcttcaacgggacggagcgggtgcggttcctggatagatacatccataaccaggag gagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctggggcgg cctgacgccgagtactggaacagccagaaggacatcctggaagacgagcgggccgcggtg gacacctactgcagacacaactacggggtttttgacagcttcacagtgcagcggcgagtc caacctagggtgactgtgtatccttcaaagacccagcctctgcagcaccacaatctcctg gtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtggttccggaatggc caggaagagaaggctggggtggtgtccacaggcctgatccagaatggagactggaccttc cagaccctggtgatgctggaaacagttcctcagagtggagagctttacacctgccaagtg gagcacccaagcgtgaccagtcctctcacagtggaatggagagcacggtctgaatctgca cagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctcttccttggggcc gggctgttcatctacttcaggaatcagaaaggacactctggacttcagccaacaggactc ctgagctga

Rhinopithecus bieti (black snub-nosed monkey): 108519885 Help Entry 108519885         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DR beta 5 chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108519885  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108519885  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108519885    04612 Antigen processing and presentation     108519885    04658 Th1 and Th2 cell differentiation     108519885    04659 Th17 cell differentiation     108519885    04672 Intestinal immune network for IgA production     108519885  09160 Human Diseases   09163 Immune disease    05310 Asthma     108519885    05322 Systemic lupus erythematosus     108519885    05323 Rheumatoid arthritis     108519885    05320 Autoimmune thyroid disease     108519885    05321 Inflammatory bowel disease     108519885    05330 Allograft rejection     108519885    05332 Graft-versus-host disease     108519885   09166 Cardiovascular disease    05416 Viral myocarditis     108519885   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108519885   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108519885    05152 Tuberculosis     108519885   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108519885    05164 Influenza A     108519885    05168 Herpes simplex virus 1 infection     108519885    05169 Epstein-Barr virus infection     108519885   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108519885    05140 Leishmaniasis     108519885  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108519885 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108519885   Exosomal proteins of epithelial cells    108519885   Exosomal proteins of breast milk    108519885 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 C2-set_2 I-set Motif Other DBs NCBI-GeneID:  108519885 NCBI-ProteinID:  XP_017714647 UniProt:  A0A2K6M1C8 LinkDB All DBs Position Un AA seq 266 aa AA seqDB search MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGTERVRYLHRDI YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDRRAAVDTYCRHNYGVVESFTV QRRVEPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIHNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgaagctctctggaggctcctgcatggcagctctcacagtgacactgatg gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgaagcaggat aagcatgagtgtcatttcttcaacgggacggagcgggtgcggtacctgcacagagacatc tacaaccaagaggaagacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg gagctggggcggcctgacgccgagtactggaacagccagaaggacatcctggaagacagg cgggccgcggtggacacctactgcagacacaactacggggttgtggagagcttcacagtg cagcggcgagttgagcctaaggtaactgtgtatcctgcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgaacggtttctatccaggcagcattgaagtcaggtgg ttccggaatggccaggaagagaaggctggggtggtgtccacaggcctgatccacaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac acctgccaagtggagcacccgagcgtgacaagccctctcacagtggaatggagagcacgg tctgaatccgcacagagcaagatgctgagtggagttgggggctttgtgctgggcctgctc ttccttggggctgggctgttcatctacttcaggaatcagaaaggacactctggacttcaa ccaacaggactcctgagctga

Rhinopithecus bieti (black snub-nosed monkey): 108540290 Help Entry 108540290         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108540290  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108540290  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108540290    04612 Antigen processing and presentation     108540290    04658 Th1 and Th2 cell differentiation     108540290    04659 Th17 cell differentiation     108540290    04672 Intestinal immune network for IgA production     108540290  09160 Human Diseases   09163 Immune disease    05310 Asthma     108540290    05322 Systemic lupus erythematosus     108540290    05323 Rheumatoid arthritis     108540290    05320 Autoimmune thyroid disease     108540290    05321 Inflammatory bowel disease     108540290    05330 Allograft rejection     108540290    05332 Graft-versus-host disease     108540290   09166 Cardiovascular disease    05416 Viral myocarditis     108540290   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108540290   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108540290    05152 Tuberculosis     108540290   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108540290    05164 Influenza A     108540290    05168 Herpes simplex virus 1 infection     108540290    05169 Epstein-Barr virus infection     108540290   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108540290    05140 Leishmaniasis     108540290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108540290 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108540290   Exosomal proteins of epithelial cells    108540290   Exosomal proteins of breast milk    108540290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set ig Ig_2 Ig_3 C2-set_2 Marek_A Motif Other DBs NCBI-GeneID:  108540290 NCBI-ProteinID:  XP_017744765 LinkDB All DBs Position Un AA seq 221 aa AA seqDB search MVLQVPGAPWTVGLMALLMVLLKPVVQGRATPENSVYQERQKCYAFNGTQRFVDGLVYNR EEYVHFDSAVGEFLAVMELGRPTGEYLNSQKDFTERKRAEVDKVCRHKYELMEPLIWQCR VHPRLNVSPSKKGPLQHHNLLVCHMTDFHPGSIQVRWFLNGQEETAGVVSTSLIRNGDWT FQILVLLEMTPQQGDIYTCQVEHPSLDSPVTVEWSEGLMTL NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atggtcctgcaggtcccaggtgccccctggacagtgggtctgatggcgttactgatggta ctgctcaaacctgtggtccagggcagggccactccagagaattccgtgtaccaggaacgg cagaaatgctacgcattcaatgggactcagcgctttgtggacgggctcgtctacaaccgg gaggaatacgtgcattttgacagcgcagtgggggagttcctagcagtgatggagctgggg cggcccacgggcgagtacttgaacagccagaaggactttacggaacggaagcgagccgag gtggacaaggtgtgcagacacaagtacgagctgatggagccactcatctggcagtgccga gtccatccgaggctgaacgtctccccctccaagaaggggcccctgcagcaccacaacctg cttgtctgccacatgacagatttccacccaggcagcattcaagtccgatggttcctgaat ggacaggaagaaacagctggggtcgtgtccaccagcctcatccgtaatggagactggacc ttccagatcctggtgttgctggaaatgaccccccagcagggagacatctacacctgccaa gtggagcaccccagcctggacagtcctgtcaccgtggagtggagtgagggtctgatgacc ctctag

Rhinopithecus bieti (black snub-nosed monkey): 108540291 Help Entry 108540291         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108540291  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108540291  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108540291    04612 Antigen processing and presentation     108540291    04658 Th1 and Th2 cell differentiation     108540291    04659 Th17 cell differentiation     108540291    04672 Intestinal immune network for IgA production     108540291  09160 Human Diseases   09163 Immune disease    05310 Asthma     108540291    05322 Systemic lupus erythematosus     108540291    05323 Rheumatoid arthritis     108540291    05320 Autoimmune thyroid disease     108540291    05321 Inflammatory bowel disease     108540291    05330 Allograft rejection     108540291    05332 Graft-versus-host disease     108540291   09166 Cardiovascular disease    05416 Viral myocarditis     108540291   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108540291   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108540291    05152 Tuberculosis     108540291   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108540291    05164 Influenza A     108540291    05168 Herpes simplex virus 1 infection     108540291    05169 Epstein-Barr virus infection     108540291   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108540291    05140 Leishmaniasis     108540291  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108540291 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108540291   Exosomal proteins of epithelial cells    108540291   Exosomal proteins of breast milk    108540291 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Marek_A C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  108540291 NCBI-ProteinID:  XP_017744766 UniProt:  A0A2K6MBS3 LinkDB All DBs Position Un AA seq 258 aa AA seqDB search MMILQVSAAPGTVALMALLMVLLTSVVKGRATPENYVFQGRQECYAFNGTQRYLERYIYN REEFVRFDSDAGEFRAVTELGRRAAENLNSQKDLLEEKRAAVDRMCRHNYELNEAVTLQR RVQPRVNIAPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW TFQILVMLEMTPQQGDVYTCQVEHPSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC GVGIFMHRRRKKVQRGSV NT seq 777 nt NT seq  +upstreamnt  +downstreamnt atgatgattctgcaggtttctgcggcccctgggacagtggctctgatggcgttactgatg gtgctgctcacatctgtggtcaagggcagggccactccagagaattacgtgttccaggga cggcaggaatgctacgcgtttaatgggacacagcgctacctggagagatatatctacaac cgggaggagttcgtgcgcttcgacagcgacgccggggagttccgggcggtgacggagctg ggacggcgtgctgcggagaacttgaacagccagaaggacctcctggaggagaagcgggca gcggtggacaggatgtgcagacacaactacgagctgaacgaggcggtgaccctgcagcgc cgagtccagccaagggtgaacatcgccccctccaagaaggggcccttacagcaccacaac ctgctcgtctgccatgtgacagatttctacccaggcagcattcaagtccgatggttcctg aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg accttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacacctgc caagtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcacagtctgat tctgcccggagtaagacgctgacgggagccgggggcttcgtgctggggctcatcatttgt ggagtgggcatcttcatgcacaggaggaggaagaaagttcaacgaggatctgtataa

Rhinopithecus bieti (black snub-nosed monkey): 108540294 Help Entry 108540294         CDS       T04641                                  Definition (RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain   KO K06752   MHC class II antigen Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb04145   Phagosome rbb04514   Cell adhesion molecules rbb04612   Antigen processing and presentation rbb04640   Hematopoietic cell lineage rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04672   Intestinal immune network for IgA production rbb04940   Type I diabetes mellitus rbb05140   Leishmaniasis rbb05145   Toxoplasmosis rbb05150   Staphylococcus aureus infection rbb05152   Tuberculosis rbb05164   Influenza A rbb05166   Human T-cell leukemia virus 1 infection rbb05168   Herpes simplex virus 1 infection rbb05169   Epstein-Barr virus infection rbb05310   Asthma rbb05320   Autoimmune thyroid disease rbb05321   Inflammatory bowel disease rbb05322   Systemic lupus erythematosus rbb05323   Rheumatoid arthritis rbb05330   Allograft rejection rbb05332   Graft-versus-host disease rbb05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     108540294  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108540294  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108540294    04612 Antigen processing and presentation     108540294    04658 Th1 and Th2 cell differentiation     108540294    04659 Th17 cell differentiation     108540294    04672 Intestinal immune network for IgA production     108540294  09160 Human Diseases   09163 Immune disease    05310 Asthma     108540294    05322 Systemic lupus erythematosus     108540294    05323 Rheumatoid arthritis     108540294    05320 Autoimmune thyroid disease     108540294    05321 Inflammatory bowel disease     108540294    05330 Allograft rejection     108540294    05332 Graft-versus-host disease     108540294   09166 Cardiovascular disease    05416 Viral myocarditis     108540294   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108540294   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     108540294    05152 Tuberculosis     108540294   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108540294    05164 Influenza A     108540294    05168 Herpes simplex virus 1 infection     108540294    05169 Epstein-Barr virus infection     108540294   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108540294    05140 Leishmaniasis     108540294  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rbb04147]     108540294 Exosome [BR:rbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108540294   Exosomal proteins of epithelial cells    108540294   Exosomal proteins of breast milk    108540294 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A Motif Other DBs NCBI-GeneID:  108540294 NCBI-ProteinID:  XP_017744767 LinkDB All DBs Position Un AA seq 294 aa AA seqDB search MLEAHSFRVSSASTWPQFLITVPVLTVINYRPHNVCPEDRMFQTRAVILRTLSLAFLLSL RRAGAIKADHVSTYAAFVQTHRPTGEYMYEFDEDEMFFVDLDKKETVWHLEEFGRAFSYE AQGGLANIAILNHNLNVTIQHSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPP VLNVTWLCNGQPVTEGVTESLFLPRTDYSFHKFHYLTFVPSAEDYYDCRVEHWGLDQPLL KHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGPL NT seq 885 nt NT seq  +upstreamnt  +downstreamnt atgctagaagcccacagtttcagagtctcatctgcctccacctggcctcagttcctcatc actgttcctgtgctcacagtcatcaattatagaccccacaacgtgtgccctgaagacaga atgttccagaccagagctgtgatcttgagaaccctctccttggctttcctgttgagtctc cgaagagctggggccatcaaggcggaccatgtgtccacttatgccgcgtttgtacagaca catagaccaacaggggagtatatgtatgagtttgatgaagatgaaatgttctttgtggat ctggacaagaaggagaccgtctggcatctggaggagtttggccgagccttttcctatgag gctcagggcgggctggctaacattgctatattgaaccacaacttgaatgtcacgatccag cattccaaccacactcaggccaccaatgatccccctgaggtgaccgtgtttcccaaggag cctgtggagctgggccaacccaacaccctcatctgccacattgacaagttcttccctcca gtgctcaatgtcacgtggctgtgcaacgggcagccagtcactgagggtgtcactgagagc ctcttcctgcccagaacagactacagcttccacaagttccattacctgacctttgtgccc tcagccgaggactactatgactgcagggtggaacactggggcttggatcagccgctcctc aagcactgggaggcccaagagccaatccagatgcctgagacaacggagactgtgctctgt gccctgggcctggtgctaggcctagtgggcatcatcgtgggcaccgtcctcatcataaag tctctgcgttctggccatgacccccgggcccaggggcccctgtga

DBGET integrated database retrieval system