KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512973
Entry
108512973         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512973
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512973
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512973
   04612 Antigen processing and presentation
    108512973
   04658 Th1 and Th2 cell differentiation
    108512973
   04659 Th17 cell differentiation
    108512973
   04672 Intestinal immune network for IgA production
    108512973
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512973
   05322 Systemic lupus erythematosus
    108512973
   05323 Rheumatoid arthritis
    108512973
   05320 Autoimmune thyroid disease
    108512973
   05321 Inflammatory bowel disease
    108512973
   05330 Allograft rejection
    108512973
   05332 Graft-versus-host disease
    108512973
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512973
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512973
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512973
   05152 Tuberculosis
    108512973
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512973
   05164 Influenza A
    108512973
   05168 Herpes simplex virus 1 infection
    108512973
   05169 Epstein-Barr virus infection
    108512973
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512973
   05140 Leishmaniasis
    108512973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512973
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512973
  Exosomal proteins of epithelial cells
   108512973
  Exosomal proteins of breast milk
   108512973
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 I-set C2-set_2 ig
Other DBs
NCBI-GeneID: 108512973
NCBI-ProteinID: XP_017704043
UniProt: A0A2K6KVH0
LinkDB
Position
Un
AA seq 263 aa
MIIFLPLLLGLSLGCTRAGGFVAHVESTCLLDDDGTAKDFTYCISFNKDLLTCWDPEENK
MVPCEFGVLNRLANGISDYLNQQDTLMQRLRNGLQNCATHTQPFWGSLTHRTRPPSVQVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGNLVIPHSSGQKTAQPNGDWTYQTLSFL
ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGLISW
RRAGSSSYTPLPGSNYPEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcatattcctgccgctgctgctggggctcagcctgggctgcacaagagcaggtggc
ttcgtggcccatgtggaaagcacctgtctactggatgatgatgggactgcaaaggatttc
acatactgtatctccttcaacaaggatctgctgacctgctgggatccagaggagaacaag
atggtcccttgtgaatttggggtgctgaatcgcttggccaatggcatctcagattacctc
aaccaacaggacaccttgatgcagcgcttgcgcaatgggcttcagaattgtgccacacat
acccagcccttctggggatcactgacccacaggacacggccaccatctgtgcaagtagcc
caaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagatgtgaccatcacgtggatgaagaatgggaatcttgtcatccctcacagc
agtggccagaagactgcccagcccaatggagactggacataccagaccctctccttttta
gccctaaccccctcttacggggacacctacacctgtgtggtggagcacattggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtttgatcagctgg
cggagagctggctcctctagttacactcctcttcctgggtccaattatccagaaggacgg
cacatttcctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512974
Entry
108512974         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512974
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512974
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512974
   04612 Antigen processing and presentation
    108512974
   04658 Th1 and Th2 cell differentiation
    108512974
   04659 Th17 cell differentiation
    108512974
   04672 Intestinal immune network for IgA production
    108512974
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512974
   05322 Systemic lupus erythematosus
    108512974
   05323 Rheumatoid arthritis
    108512974
   05320 Autoimmune thyroid disease
    108512974
   05321 Inflammatory bowel disease
    108512974
   05330 Allograft rejection
    108512974
   05332 Graft-versus-host disease
    108512974
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512974
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512974
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512974
   05152 Tuberculosis
    108512974
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512974
   05164 Influenza A
    108512974
   05168 Herpes simplex virus 1 infection
    108512974
   05169 Epstein-Barr virus infection
    108512974
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512974
   05140 Leishmaniasis
    108512974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512974
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512974
  Exosomal proteins of epithelial cells
   108512974
  Exosomal proteins of breast milk
   108512974
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 Ig_2
Other DBs
NCBI-GeneID: 108512974
NCBI-ProteinID: XP_017704045
UniProt: A0A2K6K9R8
LinkDB
Position
Un
AA seq 261 aa
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPVWRDDLQNHTFLHTVYCQDGSPSMGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKAFCELMIQQVGPQLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVD
GLSFQAFSYLNITPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtcatgaacagaatcaaggagctgcgctgctccagatgctaccacttctgtggctg
ctaccccactcctgggccgtcccagaagctcctactccagtgtggcgagatgacctgcaa
aaccacacgttcctgcacacagtgtactgccaggatgggagtcccagtatgggactctct
gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct
cgcctgcctgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt
gacaaagcgttctgcgagttgatgatccagcaagtagggccacaacttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaggtgttcacgctgaagcccctggagtttggc
aaacccaacacgttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggatctgggcctacttttgtctcagctgtcgat
ggactcagcttccaagccttttcttacttaaacatcacaccggaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccccag
aacgcactaccctcagatctgctggagaatgtgctgtgtggcgtggcctttggtttgggt
gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt
gactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512982
Entry
108512982         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512982
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512982
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512982
   04612 Antigen processing and presentation
    108512982
   04658 Th1 and Th2 cell differentiation
    108512982
   04659 Th17 cell differentiation
    108512982
   04672 Intestinal immune network for IgA production
    108512982
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512982
   05322 Systemic lupus erythematosus
    108512982
   05323 Rheumatoid arthritis
    108512982
   05320 Autoimmune thyroid disease
    108512982
   05321 Inflammatory bowel disease
    108512982
   05330 Allograft rejection
    108512982
   05332 Graft-versus-host disease
    108512982
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512982
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512982
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512982
   05152 Tuberculosis
    108512982
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512982
   05164 Influenza A
    108512982
   05168 Herpes simplex virus 1 infection
    108512982
   05169 Epstein-Barr virus infection
    108512982
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512982
   05140 Leishmaniasis
    108512982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512982
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512982
  Exosomal proteins of epithelial cells
   108512982
  Exosomal proteins of breast milk
   108512982
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 108512982
NCBI-ProteinID: XP_017704053
UniProt: A0A2K6M430
LinkDB
Position
Un
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSREAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTALLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERAGVMSTGLIGNGDWT
FQTVVILEMTPELGDVYTCLVHHSSLLSPVSVEWRVQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGDEVSRAVLLPQPC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgaccagactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgacgaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagagaggcc
gtggatggggtctgtagacacaactacagactgggcgcacccttcactgtgggaagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccgcactcctgcaccagcataatctg
ctgcactgctctgtgacgggcttctatccaggggacatcaagatcaggtggttcctgaat
gggcaggaggagagagctggggtcatgtccactggccttatcgggaatggagactggacc
tttcagactgtggtgatactagaaatgactcctgaacttggagatgtctacacctgcctt
gtccatcactccagcctgctgagccctgtttctgtggagtggagagttcagtctgaatat
tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagcttagggctcagaaaggatatgtgaggacacagatgtctggt
gatgaggtctcaagagctgttctgctccctcagccatgctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512983
Entry
108512983         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512983
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512983
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512983
   04612 Antigen processing and presentation
    108512983
   04658 Th1 and Th2 cell differentiation
    108512983
   04659 Th17 cell differentiation
    108512983
   04672 Intestinal immune network for IgA production
    108512983
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512983
   05322 Systemic lupus erythematosus
    108512983
   05323 Rheumatoid arthritis
    108512983
   05320 Autoimmune thyroid disease
    108512983
   05321 Inflammatory bowel disease
    108512983
   05330 Allograft rejection
    108512983
   05332 Graft-versus-host disease
    108512983
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512983
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512983
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512983
   05152 Tuberculosis
    108512983
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512983
   05164 Influenza A
    108512983
   05168 Herpes simplex virus 1 infection
    108512983
   05169 Epstein-Barr virus infection
    108512983
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512983
   05140 Leishmaniasis
    108512983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512983
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512983
  Exosomal proteins of epithelial cells
   108512983
  Exosomal proteins of breast milk
   108512983
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 MHC_I ig C2-set_2
Other DBs
NCBI-GeneID: 108512983
NCBI-ProteinID: XP_017704054
UniProt: A0A2K6KW97
LinkDB
Position
Un
AA seq 261 aa
MPWKKALQIPGGLWAATVTLMLAMLSTPVTEGRDSPEDFVYQFKGMCYFTNGTEHVRLVA
RHVYNREEYARFDSDVGVYRAVTPLGQSSAEYWNSQKEVLERKRAELDTVCRHNYQLELR
TTLQRRVEPTVTISPSKTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETTGIVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GMILLGLGLVIHHRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgccttggaagaaggctttgcagatccccggaggcctttgggcagcaactgtgaccttg
atgctggcgatgctaagcaccccagtgactgaaggcagagactctcccgaggatttcgtg
taccagtttaaaggcatgtgctacttcaccaacgggacagagcacgtgcggttggtagcc
agacacgtctataaccgcgaagagtacgcgcgcttcgacagcgatgtgggggtgtaccgg
gcggtgacgccgctggggcagtctagcgccgagtactggaacagccagaaggaagtcctg
gagaggaaacgggcggagttggacacggtgtgcagacacaactaccagttggagctccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaagacagaggcc
ctcaaccaccataacctgctagtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgaccaggaggagacaaccggcattgtgtccaccccccttatt
aggaacggcgactggaccttccagatcctggtgatgctggaaatgactccccagcgggga
gatgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggctttgtgctg
gggatgatcttactcgggctgggccttgtcatccatcacaggagtcagaaagggctcctg
cactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512984
Entry
108512984         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512984
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512984
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512984
   04612 Antigen processing and presentation
    108512984
   04658 Th1 and Th2 cell differentiation
    108512984
   04659 Th17 cell differentiation
    108512984
   04672 Intestinal immune network for IgA production
    108512984
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512984
   05322 Systemic lupus erythematosus
    108512984
   05323 Rheumatoid arthritis
    108512984
   05320 Autoimmune thyroid disease
    108512984
   05321 Inflammatory bowel disease
    108512984
   05330 Allograft rejection
    108512984
   05332 Graft-versus-host disease
    108512984
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512984
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512984
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512984
   05152 Tuberculosis
    108512984
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512984
   05164 Influenza A
    108512984
   05168 Herpes simplex virus 1 infection
    108512984
   05169 Epstein-Barr virus infection
    108512984
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512984
   05140 Leishmaniasis
    108512984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512984
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512984
  Exosomal proteins of epithelial cells
   108512984
  Exosomal proteins of breast milk
   108512984
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 SKG6 EF_assoc_2
Other DBs
NCBI-GeneID: 108512984
NCBI-ProteinID: XP_017704055
UniProt: A0A2K6KW15
LinkDB
Position
Un
AA seq 254 aa
MILNKALMLGALALTTVMSPSGGEEIVADHVASYGVNLYQTYGLSGQYSHEFDGDEQFYV
DLGRKETVWRLPVLSQFSFDAQFALTNIAVGKHNLNFLIKSSNSTAATNEVPEVTVFSKS
PVTLGHPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLP
SADEIYDCRVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVLIIR
GLRSVGASRHQGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgatcttaaacaaagctctgatgctgggggccctcgccctgaccaccgtgatgagcccc
agtggaggtgaagaaattgtggctgaccatgttgcctcttacggtgtaaacttgtaccag
acttacggtctctctggccagtactcccatgaatttgacggagatgagcagttctacgtg
gacctggggaggaaggagactgtctggcggttgcctgttctcagccaatttagtttcgac
gcgcaatttgcactgacaaacattgctgtgggaaaacataacttgaacttcctgattaaa
agctccaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaagtcg
cccgtgacactgggtcaccccaacaccctcatctgtcttgtggacaacatctttcctcct
gtggtgaacatcacatggttgagtaatgggcactcagtcacagaaggggtttctgagacc
agcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctccct
tctgctgatgagatttatgactgcagggtggagcactggggcctggacgagcctcttcta
aaacactgggagccggagattccagcgcccatgtcagagctcacagagactgtggtctgc
gccctggggttgtctgtgggcctcgtaggcattgtggtgggcactgtcttgatcatccga
ggcctgcgttcagttggtgcttccagacaccaagggcccttgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512985
Entry
108512985         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108512985
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512985
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512985
   04612 Antigen processing and presentation
    108512985
   04658 Th1 and Th2 cell differentiation
    108512985
   04659 Th17 cell differentiation
    108512985
   04672 Intestinal immune network for IgA production
    108512985
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108512985
   05322 Systemic lupus erythematosus
    108512985
   05323 Rheumatoid arthritis
    108512985
   05320 Autoimmune thyroid disease
    108512985
   05321 Inflammatory bowel disease
    108512985
   05330 Allograft rejection
    108512985
   05332 Graft-versus-host disease
    108512985
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108512985
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108512985
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108512985
   05152 Tuberculosis
    108512985
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512985
   05164 Influenza A
    108512985
   05168 Herpes simplex virus 1 infection
    108512985
   05169 Epstein-Barr virus infection
    108512985
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108512985
   05140 Leishmaniasis
    108512985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108512985
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108512985
  Exosomal proteins of epithelial cells
   108512985
  Exosomal proteins of breast milk
   108512985
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 108512985
NCBI-ProteinID: XP_017704057
LinkDB
Position
Un
AA seq 311 aa
MALRAGLVLGFHSLMTLLSPQEAGATKADHMGSYGPAFYQSYSTSGQFTHEFDGEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRTRAINVPPRVTVFPK
SRVELGQPNILICLVDNIFPPVINITWLRNGQAVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAKDIYDCQVEHWGLDAPLLRHWGTEPPPHAPSWPQVSFTLDSFPIPPIPSFLSQSSRC
LFNHQMPWRPSSVPWAWPLAWWASSWAPSSSSWAHMCPVPPGNDPSERNDLWETPCRSSW
ICDSSCVLSAL
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctggtcctggggttccacagcctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacagcacctcgggccagttcacccatgaatttgatggggaacagctgttctctgtg
gacctgaagaaaagtgaggctgtgtggcgtctgcctgagtttggcgactttgcccgcttt
gacccgcagggtgggctggccggcatcgccgcgatcaaagcccatctggacatcctggtg
gagcgctccaaccgcaccagagccatcaacgtgcctccacgggtgaccgtgttccccaag
tctcgggtggagttgggccagcccaacatcctcatctgcctcgtggacaacatcttccca
cctgtgatcaatatcacctggctgcgcaacggccaagctgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagccaaggacatctatgactgccaggtggagcactggggcctggatgcgccactc
ctcaggcattggggtacggagccccctccccacgcaccctcctggccccaggtttccttt
actctagattccttccctataccaccaattccttcctttctctcccagagctccaggtgc
ctattcaaccaccagatgccatggagaccctcgtctgtgccctgggcctggccattggcc
tggtgggcttcctcgtgggcaccatcctcatcatcatgggcacatatgtgtccagtgccc
ccaggtaatgatccttctgagagaaatgacttgtgggagacaccctgcagatcctcgtgg
atttgtgacagctcctgcgtgctcagtgccctttaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519881
Entry
108519881         CDS       T04641                                 

Definition
(RefSeq) mamu class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108519881
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519881
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519881
   04612 Antigen processing and presentation
    108519881
   04658 Th1 and Th2 cell differentiation
    108519881
   04659 Th17 cell differentiation
    108519881
   04672 Intestinal immune network for IgA production
    108519881
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108519881
   05322 Systemic lupus erythematosus
    108519881
   05323 Rheumatoid arthritis
    108519881
   05320 Autoimmune thyroid disease
    108519881
   05321 Inflammatory bowel disease
    108519881
   05330 Allograft rejection
    108519881
   05332 Graft-versus-host disease
    108519881
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108519881
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108519881
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108519881
   05152 Tuberculosis
    108519881
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519881
   05164 Influenza A
    108519881
   05168 Herpes simplex virus 1 infection
    108519881
   05169 Epstein-Barr virus infection
    108519881
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108519881
   05140 Leishmaniasis
    108519881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108519881
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108519881
  Exosomal proteins of epithelial cells
   108519881
  Exosomal proteins of breast milk
   108519881
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 108519881
NCBI-ProteinID: XP_017714644
UniProt: A0A2K6KYL0
LinkDB
Position
Un
AA seq 254 aa
MAVSGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNNTPITNVPPEVTVLTNS
PVELGEPNVLICFIDKFSPPVVNVTWLQNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDIYDCKVEHWGLDAPLLKHWEFDAPSPLPETKENVVCALGLIVGLVGIIVGTVFIIK
GVRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccgtaagtggagtccccgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacacgtgatcatccaggctgagttctatctgaac
cctgaccaatcaggagagtttatgtttgactttgatggtgatgagattttccacgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaacaatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgggagagcccaacgtcctcatctgtttcatcgacaagttctctccacca
gtggtcaatgttacatggcttcaaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccggaagttccactatctccccttcctgccc
tcaactgaagacatttatgactgcaaggtggagcactggggcttggatgcgccgcttctc
aagcactgggagtttgatgcaccaagccctctcccagagactaaagagaacgtggtgtgt
gccctgggcctgattgtgggtctggtgggcatcattgttgggaccgtcttcatcatcaag
ggtgtgcgcaaaagcaatgctgcagaacgcagggggcctctgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519884
Entry
108519884         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-13 beta chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108519884
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519884
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519884
   04612 Antigen processing and presentation
    108519884
   04658 Th1 and Th2 cell differentiation
    108519884
   04659 Th17 cell differentiation
    108519884
   04672 Intestinal immune network for IgA production
    108519884
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108519884
   05322 Systemic lupus erythematosus
    108519884
   05323 Rheumatoid arthritis
    108519884
   05320 Autoimmune thyroid disease
    108519884
   05321 Inflammatory bowel disease
    108519884
   05330 Allograft rejection
    108519884
   05332 Graft-versus-host disease
    108519884
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108519884
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108519884
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108519884
   05152 Tuberculosis
    108519884
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519884
   05164 Influenza A
    108519884
   05168 Herpes simplex virus 1 infection
    108519884
   05169 Epstein-Barr virus infection
    108519884
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108519884
   05140 Leishmaniasis
    108519884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108519884
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108519884
  Exosomal proteins of epithelial cells
   108519884
  Exosomal proteins of breast milk
   108519884
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 DUF202
Other DBs
NCBI-GeneID: 108519884
NCBI-ProteinID: XP_017714645
LinkDB
Position
Un
AA seq 282 aa
MCSVLDSREWKMIHREMDCAEKKEEGTGQQRGLRNSPGMLENKTREYNASRFLEQAKSEC
HFFNGTERVRFLDRYIHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAV
DTYCRHNYGVFDSFTVQRRVQPRVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNG
QEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGELYTCQVEHPSVTSPLTVEWRARSESA
QSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGLLS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtgtagtgtgttagattccagggagtggaagatgatacatagggagatggattgtgcg
gagaaaaaagaagagggcacaggccagcaaagggggctgagaaacagcccagggatgttg
gagaataaaacaagagaatataatgcgtcacgtttcttggagcaggctaagtctgagtgt
cacttcttcaacgggacggagcgggtgcggttcctggatagatacatccataaccaggag
gagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctggggcgg
cctgacgccgagtactggaacagccagaaggacatcctggaagacgagcgggccgcggtg
gacacctactgcagacacaactacggggtttttgacagcttcacagtgcagcggcgagtc
caacctagggtgactgtgtatccttcaaagacccagcctctgcagcaccacaatctcctg
gtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtggttccggaatggc
caggaagagaaggctggggtggtgtccacaggcctgatccagaatggagactggaccttc
cagaccctggtgatgctggaaacagttcctcagagtggagagctttacacctgccaagtg
gagcacccaagcgtgaccagtcctctcacagtggaatggagagcacggtctgaatctgca
cagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctcttccttggggcc
gggctgttcatctacttcaggaatcagaaaggacactctggacttcagccaacaggactc
ctgagctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519885
Entry
108519885         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR beta 5 chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108519885
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519885
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519885
   04612 Antigen processing and presentation
    108519885
   04658 Th1 and Th2 cell differentiation
    108519885
   04659 Th17 cell differentiation
    108519885
   04672 Intestinal immune network for IgA production
    108519885
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108519885
   05322 Systemic lupus erythematosus
    108519885
   05323 Rheumatoid arthritis
    108519885
   05320 Autoimmune thyroid disease
    108519885
   05321 Inflammatory bowel disease
    108519885
   05330 Allograft rejection
    108519885
   05332 Graft-versus-host disease
    108519885
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108519885
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108519885
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108519885
   05152 Tuberculosis
    108519885
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519885
   05164 Influenza A
    108519885
   05168 Herpes simplex virus 1 infection
    108519885
   05169 Epstein-Barr virus infection
    108519885
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108519885
   05140 Leishmaniasis
    108519885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108519885
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108519885
  Exosomal proteins of epithelial cells
   108519885
  Exosomal proteins of breast milk
   108519885
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 C2-set_2 I-set
Other DBs
NCBI-GeneID: 108519885
NCBI-ProteinID: XP_017714647
UniProt: A0A2K6M1C8
LinkDB
Position
Un
AA seq 266 aa
MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGTERVRYLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDRRAAVDTYCRHNYGVVESFTV
QRRVEPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctctctggaggctcctgcatggcagctctcacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgaagcaggat
aagcatgagtgtcatttcttcaacgggacggagcgggtgcggtacctgcacagagacatc
tacaaccaagaggaagacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgccgagtactggaacagccagaaggacatcctggaagacagg
cgggccgcggtggacacctactgcagacacaactacggggttgtggagagcttcacagtg
cagcggcgagttgagcctaaggtaactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaacggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaaggctggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccgagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatccgcacagagcaagatgctgagtggagttgggggctttgtgctgggcctgctc
ttccttggggctgggctgttcatctacttcaggaatcagaaaggacactctggacttcaa
ccaacaggactcctgagctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540290
Entry
108540290         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108540290
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108540290
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108540290
   04612 Antigen processing and presentation
    108540290
   04658 Th1 and Th2 cell differentiation
    108540290
   04659 Th17 cell differentiation
    108540290
   04672 Intestinal immune network for IgA production
    108540290
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108540290
   05322 Systemic lupus erythematosus
    108540290
   05323 Rheumatoid arthritis
    108540290
   05320 Autoimmune thyroid disease
    108540290
   05321 Inflammatory bowel disease
    108540290
   05330 Allograft rejection
    108540290
   05332 Graft-versus-host disease
    108540290
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108540290
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108540290
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108540290
   05152 Tuberculosis
    108540290
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540290
   05164 Influenza A
    108540290
   05168 Herpes simplex virus 1 infection
    108540290
   05169 Epstein-Barr virus infection
    108540290
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108540290
   05140 Leishmaniasis
    108540290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108540290
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108540290
  Exosomal proteins of epithelial cells
   108540290
  Exosomal proteins of breast milk
   108540290
SSDB
Motif
Pfam: MHC_II_beta C1-set ig Ig_2 Ig_3 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 108540290
NCBI-ProteinID: XP_017744765
LinkDB
Position
Un
AA seq 221 aa
MVLQVPGAPWTVGLMALLMVLLKPVVQGRATPENSVYQERQKCYAFNGTQRFVDGLVYNR
EEYVHFDSAVGEFLAVMELGRPTGEYLNSQKDFTERKRAEVDKVCRHKYELMEPLIWQCR
VHPRLNVSPSKKGPLQHHNLLVCHMTDFHPGSIQVRWFLNGQEETAGVVSTSLIRNGDWT
FQILVLLEMTPQQGDIYTCQVEHPSLDSPVTVEWSEGLMTL
NT seq 666 nt   +upstreamnt  +downstreamnt
atggtcctgcaggtcccaggtgccccctggacagtgggtctgatggcgttactgatggta
ctgctcaaacctgtggtccagggcagggccactccagagaattccgtgtaccaggaacgg
cagaaatgctacgcattcaatgggactcagcgctttgtggacgggctcgtctacaaccgg
gaggaatacgtgcattttgacagcgcagtgggggagttcctagcagtgatggagctgggg
cggcccacgggcgagtacttgaacagccagaaggactttacggaacggaagcgagccgag
gtggacaaggtgtgcagacacaagtacgagctgatggagccactcatctggcagtgccga
gtccatccgaggctgaacgtctccccctccaagaaggggcccctgcagcaccacaacctg
cttgtctgccacatgacagatttccacccaggcagcattcaagtccgatggttcctgaat
ggacaggaagaaacagctggggtcgtgtccaccagcctcatccgtaatggagactggacc
ttccagatcctggtgttgctggaaatgaccccccagcagggagacatctacacctgccaa
gtggagcaccccagcctggacagtcctgtcaccgtggagtggagtgagggtctgatgacc
ctctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540291
Entry
108540291         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108540291
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108540291
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108540291
   04612 Antigen processing and presentation
    108540291
   04658 Th1 and Th2 cell differentiation
    108540291
   04659 Th17 cell differentiation
    108540291
   04672 Intestinal immune network for IgA production
    108540291
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108540291
   05322 Systemic lupus erythematosus
    108540291
   05323 Rheumatoid arthritis
    108540291
   05320 Autoimmune thyroid disease
    108540291
   05321 Inflammatory bowel disease
    108540291
   05330 Allograft rejection
    108540291
   05332 Graft-versus-host disease
    108540291
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108540291
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108540291
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108540291
   05152 Tuberculosis
    108540291
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540291
   05164 Influenza A
    108540291
   05168 Herpes simplex virus 1 infection
    108540291
   05169 Epstein-Barr virus infection
    108540291
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108540291
   05140 Leishmaniasis
    108540291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108540291
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108540291
  Exosomal proteins of epithelial cells
   108540291
  Exosomal proteins of breast milk
   108540291
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 108540291
NCBI-ProteinID: XP_017744766
UniProt: A0A2K6MBS3
LinkDB
Position
Un
AA seq 258 aa
MMILQVSAAPGTVALMALLMVLLTSVVKGRATPENYVFQGRQECYAFNGTQRYLERYIYN
REEFVRFDSDAGEFRAVTELGRRAAENLNSQKDLLEEKRAAVDRMCRHNYELNEAVTLQR
RVQPRVNIAPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHPSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRRKKVQRGSV
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatgattctgcaggtttctgcggcccctgggacagtggctctgatggcgttactgatg
gtgctgctcacatctgtggtcaagggcagggccactccagagaattacgtgttccaggga
cggcaggaatgctacgcgtttaatgggacacagcgctacctggagagatatatctacaac
cgggaggagttcgtgcgcttcgacagcgacgccggggagttccgggcggtgacggagctg
ggacggcgtgctgcggagaacttgaacagccagaaggacctcctggaggagaagcgggca
gcggtggacaggatgtgcagacacaactacgagctgaacgaggcggtgaccctgcagcgc
cgagtccagccaagggtgaacatcgccccctccaagaaggggcccttacagcaccacaac
ctgctcgtctgccatgtgacagatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacacctgc
caagtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcacagtctgat
tctgcccggagtaagacgctgacgggagccgggggcttcgtgctggggctcatcatttgt
ggagtgggcatcttcatgcacaggaggaggaagaaagttcaacgaggatctgtataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540294
Entry
108540294         CDS       T04641                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04612  Antigen processing and presentation
rbb04640  Hematopoietic cell lineage
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108540294
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108540294
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108540294
   04612 Antigen processing and presentation
    108540294
   04658 Th1 and Th2 cell differentiation
    108540294
   04659 Th17 cell differentiation
    108540294
   04672 Intestinal immune network for IgA production
    108540294
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108540294
   05322 Systemic lupus erythematosus
    108540294
   05323 Rheumatoid arthritis
    108540294
   05320 Autoimmune thyroid disease
    108540294
   05321 Inflammatory bowel disease
    108540294
   05330 Allograft rejection
    108540294
   05332 Graft-versus-host disease
    108540294
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108540294
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108540294
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108540294
   05152 Tuberculosis
    108540294
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540294
   05164 Influenza A
    108540294
   05168 Herpes simplex virus 1 infection
    108540294
   05169 Epstein-Barr virus infection
    108540294
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108540294
   05140 Leishmaniasis
    108540294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108540294
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108540294
  Exosomal proteins of epithelial cells
   108540294
  Exosomal proteins of breast milk
   108540294
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 108540294
NCBI-ProteinID: XP_017744767
LinkDB
Position
Un
AA seq 294 aa
MLEAHSFRVSSASTWPQFLITVPVLTVINYRPHNVCPEDRMFQTRAVILRTLSLAFLLSL
RRAGAIKADHVSTYAAFVQTHRPTGEYMYEFDEDEMFFVDLDKKETVWHLEEFGRAFSYE
AQGGLANIAILNHNLNVTIQHSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPP
VLNVTWLCNGQPVTEGVTESLFLPRTDYSFHKFHYLTFVPSAEDYYDCRVEHWGLDQPLL
KHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGPL
NT seq 885 nt   +upstreamnt  +downstreamnt
atgctagaagcccacagtttcagagtctcatctgcctccacctggcctcagttcctcatc
actgttcctgtgctcacagtcatcaattatagaccccacaacgtgtgccctgaagacaga
atgttccagaccagagctgtgatcttgagaaccctctccttggctttcctgttgagtctc
cgaagagctggggccatcaaggcggaccatgtgtccacttatgccgcgtttgtacagaca
catagaccaacaggggagtatatgtatgagtttgatgaagatgaaatgttctttgtggat
ctggacaagaaggagaccgtctggcatctggaggagtttggccgagccttttcctatgag
gctcagggcgggctggctaacattgctatattgaaccacaacttgaatgtcacgatccag
cattccaaccacactcaggccaccaatgatccccctgaggtgaccgtgtttcccaaggag
cctgtggagctgggccaacccaacaccctcatctgccacattgacaagttcttccctcca
gtgctcaatgtcacgtggctgtgcaacgggcagccagtcactgagggtgtcactgagagc
ctcttcctgcccagaacagactacagcttccacaagttccattacctgacctttgtgccc
tcagccgaggactactatgactgcagggtggaacactggggcttggatcagccgctcctc
aagcactgggaggcccaagagccaatccagatgcctgagacaacggagactgtgctctgt
gccctgggcctggtgctaggcctagtgggcatcatcgtgggcaccgtcctcatcataaag
tctctgcgttctggccatgacccccgggcccaggggcccctgtga

DBGET integrated database retrieval system