KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513078
Entry
108513078         CDS       T04641                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03460  Fanconi anemia pathway
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    108513078 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108513078 (POLK)
   05202 Transcriptional misregulation in cancer
    108513078 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108513078 (POLK)
   05212 Pancreatic cancer
    108513078 (POLK)
   05225 Hepatocellular carcinoma
    108513078 (POLK)
   05226 Gastric cancer
    108513078 (POLK)
   05214 Glioma
    108513078 (POLK)
   05216 Thyroid cancer
    108513078 (POLK)
   05220 Chronic myeloid leukemia
    108513078 (POLK)
   05217 Basal cell carcinoma
    108513078 (POLK)
   05218 Melanoma
    108513078 (POLK)
   05213 Endometrial cancer
    108513078 (POLK)
   05224 Breast cancer
    108513078 (POLK)
   05222 Small cell lung cancer
    108513078 (POLK)
   05223 Non-small cell lung cancer
    108513078 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    108513078 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108513078 (POLK)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108513078 (POLK)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    108513078 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 108513078
NCBI-ProteinID: XP_017704210
LinkDB
Position
Un
AA seq 847 aa
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRKYFIKMGNSVENDNPGKEINK
LSEHERSISPLXFEESPSDLQXPGDPFQVNFEEQNSPQILQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTYLTRDGERKSMSVER
TFSEINKAEEQYSLCEELCSELARDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQAL
SATGCILEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCETVNKQSFQTSQPFE
VLKKKMSENLEISENSDACQIFTCPVCFRAQGCISLEAFNKHVDACLDGSSISENSKVFS
CSHVSATRVNKKENVPASSLCEKQDYEAHPKIKEVSSVDCVALVDTIDNSSKAESIDALS
NKHIKEECSDLPGKSFNIEHCHQNSSCTVSLENEDVGLLSRQESCQPYLCEVITGQALVC
PVCNVEQKTSDLTLFNVHVDVCLNKNFIQELKKDKVNPVNQPKESSRSTGSSSGVQKAVT
KQKVWLI
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccagattttatggaaatgagctcaagaaagaaaagcaggtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccatcgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggaggtttggtgttcgtgcagccatgccaggatttattgctaagagactc
tgcccacaacttataatagtgcccccaaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaaag
tatttcatcaaaatgggaaactctgtagaaaatgataatccaggaaaggaaattaataaa
ctgagtgagcatgaacgatccatctctccactancttttgaagagagtccttctgatttg
cagnccccaggagatcctttccaagtgaactttgaagaacaaaacagtcctcaaatactc
caaaactcaattgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcaga
attgagcaaaaaacaacattgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttgaaggcccttggaattattacatgtacagaactttaccaacagaga
gcattgctttctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacatacctgacaagggatggagagaggaagagtatgagcgttgagagg
acattcagtgagattaataaagcggaagaacaatacagcctatgtgaagaactttgcagt
gaacttgctcgagatctacagaaagaaggacttaagggtagaactgttaccattaaattg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaggaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaagacttatgggtgttcggatatctagttttcccaatgaagaa
gacaggaaacaccaacaaaggagcattattggctttttacaggctggaaaccaagccctg
tcagccactgggtgtatactagagaaaacggacaaagataagtttgtaaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgaaaccgtgaataaacaaagtttccagacatcacaaccattcgaa
gttttaaagaagaagatgagtgagaatttggaaatatcagagaattcagatgcctgtcag
atatttacctgtcctgtttgctttagggcacaagggtgcatcagtctggaagcctttaat
aaacatgtagatgcatgtcttgatggatcttcaatcagtgaaaactctaaagtgttctcg
tgttcacatgtttctgctaccagagttaacaagaaagaaaatgttcctgcttcttcactt
tgtgagaagcaagattatgaagcccatccaaaaattaaagaagtgtcttcagtagattgt
gtagctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaagt
aataagcatatcaaggaggaatgttctgatctcccaggcaagtcttttaatattgagcac
tgtcatcagaattcttcttgcactgtttcgttggaaaacgaagatgttggattattaagc
agacaagaatcctgccagccttacttatgtgaagtgataacaggccaagctctagtttgt
cctgtttgtaatgtagaacaaaagacttcagatctaaccttgttcaatgtgcatgtggat
gtttgcttaaataaaaattttattcaagaattaaaaaaggacaaagttaacccagttaat
caacccaaagaaagctccagaagtactggtagctcaagtggagtacagaaggctgtaaca
aaacaaaaggtatggctaatttga

DBGET integrated database retrieval system