KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513168
Entry
108513168         CDS       T04641                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03320  PPAR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04659  Th17 cell differentiation
rbb04919  Thyroid hormone signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04932  Non-alcoholic fatty liver disease
rbb04976  Bile secretion
rbb05160  Hepatitis C
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05216  Thyroid cancer
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108513168 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108513168 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108513168 (RXRA)
   03320 PPAR signaling pathway
    108513168 (RXRA)
   04919 Thyroid hormone signaling pathway
    108513168 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    108513168 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    108513168 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108513168 (RXRA)
   05202 Transcriptional misregulation in cancer
    108513168 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    108513168 (RXRA)
   05216 Thyroid cancer
    108513168 (RXRA)
   05222 Small cell lung cancer
    108513168 (RXRA)
   05223 Non-small cell lung cancer
    108513168 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108513168 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108513168 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108513168 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rbb03310]
    108513168 (RXRA)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    108513168 (RXRA)
Nuclear receptors [BR:rbb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   108513168 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108513168
NCBI-ProteinID: XP_017704346
LinkDB
Position
Un
AA seq 456 aa
MLSDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFS
VISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGN
MASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNR
CQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKT
ETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTE
LGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALR
SIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgctttctgatttctccacccaggtgaactcctccctcacctccccgacggggcgaggc
tccatggctgcgccctcgctgcacccgtccctggggcctggcatcggctccccagggcag
ttgcactctcccatcagcaccctgagctcccccatcaatggcatgggcccgcccttctcg
gtcatcagctcccccatgggcccccactccatgtcggtgcccaccacgcccaccctgggc
ttcagcactggcagcccccagctcagctcacccatgaaccccgtcagcagtagcgaggac
atcaagccccccctgggcctcaatggcgtcctcaaggtccccgcccacccctcaggaaac
atggcttccttcaccaagcacatctgcgccatctgcggggaccgctcctcaggcaagcac
tacggggtgtacagctgcgaggggtgcaagggcttcttcaagcggacggtgcgcaaggac
ctgacctacacctgccgcgacaacaaggactgcctgattgacaagcggcagcggaaccgg
tgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaagctgtgcag
gaggagcggcagcgtggcaaggaccggaacgagaatgaggtggagtcgaccagcagcgcc
aacgaggacatgccggtggagaggatcctggaggctgagctggccgtggagcccaagact
gagacctacgtggaggcgaacatggggctgaaccctagctcgccgaatgaccccgtcacc
aacatttgccaagcagccgacaagcagctcttcacgctggtggagtgggccaagcggatc
ccacacttctcagagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaat
gaactgctcatcgcctccttctcccaccgctccatcgctgtgaaggacgggatcctcctg
gccactgggctgcacgtccaccggaacagcgcccacagtgcaggggtgggcgccatcttt
gacagggtgctgacggagctcgtgtccaagatgcgggacatgcagatggacaagacggag
ctgggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctctcgaacccg
gccgaggtggaggcactgagggagaaggtctacgcgtccctggaggcctactgcaagcac
aagtacccagagcagccaggaaggttcgccaagctgttgctccgcctgccggctctgcgc
tccatcgggctcaagtgcctggaacatctcttcttcttcaagctcattggggacacgccc
attgacaccttcctcatggagatgctggaggcgccgcaccaaatgacttag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538378
Entry
108538378         CDS       T04641                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03320  PPAR signaling pathway
rbb04659  Th17 cell differentiation
rbb04919  Thyroid hormone signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05216  Thyroid cancer
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108538378 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108538378 (RXRG)
   03320 PPAR signaling pathway
    108538378 (RXRG)
   04919 Thyroid hormone signaling pathway
    108538378 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    108538378 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538378 (RXRG)
   05202 Transcriptional misregulation in cancer
    108538378 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    108538378 (RXRG)
   05216 Thyroid cancer
    108538378 (RXRG)
   05222 Small cell lung cancer
    108538378 (RXRG)
   05223 Non-small cell lung cancer
    108538378 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108538378 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rbb03310]
    108538378 (RXRG)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    108538378 (RXRG)
Nuclear receptors [BR:rbb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   108538378 (RXRG)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108538378
NCBI-ProteinID: XP_017741916
UniProt: A0A2K6M5E4
LinkDB
Position
Un
AA seq 463 aa
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccgtatcgagtcatcacctctgccatgggcccaccc
tcaggagcactggcagcacctccaggaatcaacctggttgccccacccagctctcagcta
aatgtggtcaacagcgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccccggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactatggggtgtacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgtctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgggagcgagct
gagagtgaggcagaatgtgccagtagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctctttaacccagat
gccaagggcctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgtctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgttg
cagatcacctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540287
Entry
108540287         CDS       T04641                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03320  PPAR signaling pathway
rbb04659  Th17 cell differentiation
rbb04919  Thyroid hormone signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05216  Thyroid cancer
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108540287 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108540287 (RXRB)
   03320 PPAR signaling pathway
    108540287 (RXRB)
   04919 Thyroid hormone signaling pathway
    108540287 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    108540287 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540287 (RXRB)
   05202 Transcriptional misregulation in cancer
    108540287 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    108540287 (RXRB)
   05216 Thyroid cancer
    108540287 (RXRB)
   05222 Small cell lung cancer
    108540287 (RXRB)
   05223 Non-small cell lung cancer
    108540287 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108540287 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rbb03310]
    108540287 (RXRB)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    108540287 (RXRB)
Nuclear receptors [BR:rbb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   108540287 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108540287
NCBI-ProteinID: XP_017744757
LinkDB
Position
Un
AA seq 440 aa
MPQGSVGRWGCEKKCIVGSRPGGGGDGPGWIPQRRRRRRWQAENNKPRSRSRGRLDGTGW
ATAGGINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKH
YGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQ
EERQRGKDKDGDGEGLGSPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILL
ATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKG
LSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccgcagggcagtgtgggccggtgggggtgcgaaaagaaatgcattgtggggtcgcgt
cccggtggcggcggcgacggccctggctggatcccgcagcggcggcggcggcggcggtgg
caggcggagaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgg
gcgacagcgggcgggattaactcaacagtgtcactccctgggggtgggtctggcccccct
gaagatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctccaggt
ggccctggggctggcaaacggctatgtgcaatctgcggggacagaagctcaggcaaacac
tacggggtttacagctgtgagggttgcaagggcttcttcaaacgcaccatccgcaaggac
cttacatactcttgccgggacaacaaagactgcacagtggacaagcgccagcggaaccgc
tgtcagtactgccgctatcagaagtgcctggccactggcatgaagagggaggcggtacag
gaggagcgtcagcggggaaaagacaaggatggggatggggaggggctggggagccccgag
gagatgcctgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgaccag
ggcgttgagggtcctgggggaaccgggggtagcggcagcagtccaaatgaccccgtgact
aacatctgtcaggcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatc
ccacacttttcctccttgcctctggatgatcaggtcatattgctgcgggcaggctggaat
gagctcctcattgcctccttctcccaccgatccattgacgttcgagatggcatcctcctt
gccacaggtcttcacgtgcaccgcaactcagcccattcggcaggagtaggagccatcttt
gatcggtccctctccagggtgctgacagagctagtgtccaaaatgcgagacatgaggatg
gacaagacagagcttggctgcctgagggcaatcattctgtttaatccagatgccaagggg
ctctccaaccctagtgaggtggaggtcctgcgggagaaagtgtatgcatcactggagacc
tactgcaaacagaagtaccctgagcagcagggacggtttgccaagctgctgctacgtctt
cctgccctccggtccatcggccttaagtgtctagagcatctgtttttcttcaagctcatt
ggtgacacccccattgataccttcctcatggagatgcttgaggctccccatcaactggcc
tga

DBGET integrated database retrieval system