KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513636
Entry
108513636         CDS       T04641                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04068  FoxO signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04935  Growth hormone synthesis, secretion and action
rbb05034  Alcoholism
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108513636 (SOS2)
   04012 ErbB signaling pathway
    108513636 (SOS2)
   04014 Ras signaling pathway
    108513636 (SOS2)
   04630 JAK-STAT signaling pathway
    108513636 (SOS2)
   04068 FoxO signaling pathway
    108513636 (SOS2)
   04072 Phospholipase D signaling pathway
    108513636 (SOS2)
   04151 PI3K-Akt signaling pathway
    108513636 (SOS2)
   04150 mTOR signaling pathway
    108513636 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108513636 (SOS2)
   04540 Gap junction
    108513636 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108513636 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108513636 (SOS2)
   04660 T cell receptor signaling pathway
    108513636 (SOS2)
   04662 B cell receptor signaling pathway
    108513636 (SOS2)
   04664 Fc epsilon RI signaling pathway
    108513636 (SOS2)
   04062 Chemokine signaling pathway
    108513636 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108513636 (SOS2)
   04912 GnRH signaling pathway
    108513636 (SOS2)
   04915 Estrogen signaling pathway
    108513636 (SOS2)
   04917 Prolactin signaling pathway
    108513636 (SOS2)
   04926 Relaxin signaling pathway
    108513636 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    108513636 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108513636 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    108513636 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108513636 (SOS2)
   05206 MicroRNAs in cancer
    108513636 (SOS2)
   05205 Proteoglycans in cancer
    108513636 (SOS2)
   05231 Choline metabolism in cancer
    108513636 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108513636 (SOS2)
   05225 Hepatocellular carcinoma
    108513636 (SOS2)
   05226 Gastric cancer
    108513636 (SOS2)
   05214 Glioma
    108513636 (SOS2)
   05221 Acute myeloid leukemia
    108513636 (SOS2)
   05220 Chronic myeloid leukemia
    108513636 (SOS2)
   05211 Renal cell carcinoma
    108513636 (SOS2)
   05215 Prostate cancer
    108513636 (SOS2)
   05213 Endometrial cancer
    108513636 (SOS2)
   05224 Breast cancer
    108513636 (SOS2)
   05223 Non-small cell lung cancer
    108513636 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    108513636 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108513636 (SOS2)
   05160 Hepatitis C
    108513636 (SOS2)
   05163 Human cytomegalovirus infection
    108513636 (SOS2)
   05165 Human papillomavirus infection
    108513636 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108513636 (SOS2)
   01522 Endocrine resistance
    108513636 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rbb04990]
    108513636 (SOS2)
Domain-containing proteins not elsewhere classified [BR:rbb04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   108513636 (SOS2)
SSDB
Motif
Pfam: RasGEF_N RasGEF RhoGEF Histone PH PH_19 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 108513636
NCBI-ProteinID: XP_017704940
UniProt: A0A2K6MLE2
LinkDB
Position
Un
AA seq 1235 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFNEHFNKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCPFYSHQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSVVFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPTPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTDADKLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPAIEWHISKPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFERFFENLNPMGN
ASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPT
PLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSI
FAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPP
RQPPPPKVKPRVPVPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPP
PLGHLHRDSDWLRDISTCPNSPSTPPSTPSPRVPRRCYVLSSSQNNLAHPPAPPVPPRQN
SSPHLPKLPPKTYKRELSHPPLYRLPLLENAETPQ
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccttacgagttcttcagtgaggagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggaacaagtgcatcccactctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccagccaaggactgttcaagatgtagaggagcgagttcagaagacctttcctcac
ccaattgataaatgggccattgctgatgcacaatctgctatagaaaaacgaaaacgaaga
aatcctcttttactgcctgtggacaaaatccatccttcgttgaaggaagtgttagggtac
aaagtggactaccatgtgtccctatatattgtggctgtactagaatatatctcagctgat
attttaaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcggataaggttttgatggacatgtttgatcaggatgat
ataggtttggtttctctctgtgaagatgaacctagttcttccggtgaattaaactactat
gatcttgtcagaactgaaatcgcagaagaaagacagtatctacgggaattaaatatgatc
ataaaagtgtttcgagaagcctttctttctgatagaaagctgtttaaaccttctgatatt
gaaaagatttttagtaacatttcagatatacatgaattgactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcgtttgatccttatgaaacattatcacaggacatt
ctttcaccagagtttaatgaacatttcaataaattgatggccagacctgcagttgctcta
cactttcagtccattgctgatggctttaaagaggcagttcgttatgtccttccacgtctt
atgctggtgccagtatatcactgttggcactattttgagttactaaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagcatggaccgaatttacaagcagcattcacctagacgccgacctggagat
cctgtttgccctttttatagtcaccaattaagaagcaaacacctggctatcaaaaaaatg
aatgaaattcagaaaaatatcgatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggagggaccattgacaagaatcggtgccaaacatgaacggcatattttt
ctgtttgatggcttaatgatcagttgtaaacctaatcatggccagactcggcttccaggt
tacagtagtgcagaatataggttaaaagaaaaatttgtcatgaggaaaatacaaatttgt
gataaagaagatacttgtgagtgcaagcatgcttttgaattagtatccaaagatgagaac
agcgtagtatttgctgctaagtctgctgaagaaaaaaacaactggatggcagccctgatt
tctcttcattatcgtagtactctagatcgaatgttagattcagtattactgaaagaagaa
aatgagcaaccactgagattaccaactcctgaagtatatcgttttgtagtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggcatccccattattaaa
ggaggaactgtagtgaagttaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttaccacatatcgttcattttgtaaaccacaggaattgctgagc
ttactgattgaacggtttgaaatcccagagccagaacctactgacgcagacaaattggca
atagagaaaggcgagcagccaatcagtgcagaccttaaaagatttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtatttcggcattgggttgaacatcatttttat
gactttgaaagagatttggaattgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaatcgctaagatcatcaagaggaagaagcaa
gctcaggcaaacggaataagccataatattacctttgaaagtccacctccagcaattgaa
tggcatatcagcaaaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggagtctgatctctacaggaaagttcaaccatct
gaacttgtaggaagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaatctcaccctctggtttgaaaaatgcattgtggaagca
gaaaattttgaagaacgggttgcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggcgtattggagatagtcagtgcagtaaattcagtgtca
gtatacagactagaccatacctttgagagattctttgaaaaccttaaccccatgggaaat
gcgtctgaaaaagagtttacagattatttgttcaacaagtcactagaaattgaacctcga
aactgcaaacagccacctcgatttcctagaaaatcaactttctccttgaaatctcctgga
ataaggcctaacacaggccgacatggctctacctcaggtactttacgaggtcacccaaca
ccattagaaagagaaccatgtaaaataagctttagtcggattgctgaaactgagctggaa
tcaacagtgtcagcaccaacttctccaaatacaccatctactccaccagtatctgcttct
tcagaccttagtgtatttttagatgtggatctcaacagctcctgtggcagcaatagcatc
tttgctccagtgcttttgccacattcaaagtctttctttagttcatgtggtagtttacat
aaactaagtgaagagcccctgattcctcctcctcttcctcctcgaaaaaagtttgatcat
gatgcttcaaattccaagggaaatatgaaatctgatgatgatcctcctgctattccaccg
agacagcctcctcctcccaaggtaaaacccagagttcctgttcctactggtgcatttgat
gggcctctgcatagtccacctccaccaccaccaagagatcctcttcctgatacccctcca
ccggttccccttcggcctccagaacactttataaactgtccatttaatcttcagccacct
ccactggggcatcttcacagagattcagactggctcagagacattagtacgtgtccaaat
tcgccaagcactcctcctagcacaccctctccaagggtaccacgtcgatgctatgtgctc
agttctagtcagaataatcttgctcatcctccagctccccctgttccaccaaggcagaat
tcaagccctcatctgccaaaactgccaccaaagacttacaaacgggagctttcgcacccc
ccattgtacagactgcctttgctagaaaatgcagaaactccgcaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520869
Entry
108520869         CDS       T04641                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04068  FoxO signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04935  Growth hormone synthesis, secretion and action
rbb05034  Alcoholism
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108520869 (SOS1)
   04012 ErbB signaling pathway
    108520869 (SOS1)
   04014 Ras signaling pathway
    108520869 (SOS1)
   04630 JAK-STAT signaling pathway
    108520869 (SOS1)
   04068 FoxO signaling pathway
    108520869 (SOS1)
   04072 Phospholipase D signaling pathway
    108520869 (SOS1)
   04151 PI3K-Akt signaling pathway
    108520869 (SOS1)
   04150 mTOR signaling pathway
    108520869 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108520869 (SOS1)
   04540 Gap junction
    108520869 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108520869 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108520869 (SOS1)
   04660 T cell receptor signaling pathway
    108520869 (SOS1)
   04662 B cell receptor signaling pathway
    108520869 (SOS1)
   04664 Fc epsilon RI signaling pathway
    108520869 (SOS1)
   04062 Chemokine signaling pathway
    108520869 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108520869 (SOS1)
   04912 GnRH signaling pathway
    108520869 (SOS1)
   04915 Estrogen signaling pathway
    108520869 (SOS1)
   04917 Prolactin signaling pathway
    108520869 (SOS1)
   04926 Relaxin signaling pathway
    108520869 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    108520869 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108520869 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    108520869 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108520869 (SOS1)
   05206 MicroRNAs in cancer
    108520869 (SOS1)
   05205 Proteoglycans in cancer
    108520869 (SOS1)
   05231 Choline metabolism in cancer
    108520869 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108520869 (SOS1)
   05225 Hepatocellular carcinoma
    108520869 (SOS1)
   05226 Gastric cancer
    108520869 (SOS1)
   05214 Glioma
    108520869 (SOS1)
   05221 Acute myeloid leukemia
    108520869 (SOS1)
   05220 Chronic myeloid leukemia
    108520869 (SOS1)
   05211 Renal cell carcinoma
    108520869 (SOS1)
   05215 Prostate cancer
    108520869 (SOS1)
   05213 Endometrial cancer
    108520869 (SOS1)
   05224 Breast cancer
    108520869 (SOS1)
   05223 Non-small cell lung cancer
    108520869 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    108520869 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108520869 (SOS1)
   05160 Hepatitis C
    108520869 (SOS1)
   05163 Human cytomegalovirus infection
    108520869 (SOS1)
   05165 Human papillomavirus infection
    108520869 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108520869 (SOS1)
   01522 Endocrine resistance
    108520869 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rbb04990]
    108520869 (SOS1)
Domain-containing proteins not elsewhere classified [BR:rbb04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   108520869 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 PH_13 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 108520869
NCBI-ProteinID: XP_017715896
LinkDB
Position
Un
AA seq 1231 aa
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSRCKNSKCIKIMSKHLDSPPAI
PPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKS
DHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHI
PKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3696 nt   +upstreamnt  +downstreamnt
atgctatgccaagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagt
ttccctcatccaattgataagtgggcaatagctgatgcccaatcagctattgaaaagagg
aagcgaagaaaccctttatctctcccagtagaaaaaatccatcctttattaaaggaggtc
ctaggttataaaattgaccatcaggtttctgtttacatagtagcagtcttagaatacatt
tcagcagacattttaaagctggttgggaattatgtaagaaatatacggcattatgaaatt
acaaaacaagatattaaagtggcaatgtgtgctgacaaggtattgatggatatgtttcat
caagatgtagaagatattaatatattatctttaactgatgaagagccttccacctcagga
gaacaaacttactatgatttggtaaaagcatttatggcagaaattcgacaatatataagg
gaactaaatctaattataaaagtttttagagagccctttgtctccaattcaaaattgttt
tcagctaatgatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgta
aagttactgggccatatagaagatacagtagaaatgacagatgaaggcagtccccatcca
ctagtaggaagctgctttgaagacttagcagaggaactggcatttgatccgtatgaatcg
tatgctcgagatattttgcgacctggttttcatgatcgtttccttagtcagttatcaaag
cctggggcagcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatat
gttttacccaggctgcttctggcccctgtttaccactgtctccattactttgaacttttg
aagcagttagaagaaaaaagtgaagatcaagaagacaaggaatgtttaaaacaagcaata
acagctttgcttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaa
cgaagactgagtgaatctgcatgtcggttttatagtcaacaaatgaaggggaaacaacta
gcaatcaagaaaatgaatgagattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacat
gagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcag
ccaagacttcctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcga
aaggtacaaatcaatgataaagatgacaccaatgaatacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattgg
atggcagcactgatatctttacagtaccggagtacactggaaaggatgcttgatgtaaca
atgctacaagaagagaaagaggagcagatgaggctgcctagtgctgatgtttatagattt
gcggagcctgactctgaagagaatattatatttgaagagaacatgcagcccaaggctgga
attccaattatcaaagcaggaactgttattaaacttatagagaggcttacgtaccatatg
tacgcagatcccaattttgttcggacatttcttacaacatacagatccttttgcaaacct
caagaactactgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaa
gctgatcgcatagctatagagaatggagatcaacccttgagtgcagaactgaaaagattt
agaaaagaatatatacagcctgtgcaactgcgagtattaaatgtatgtcggcactgggta
gagcaccacttctatgattttgaaagagatgcatatcttttgcaacgaatggaagaattt
attggaacagtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatc
caaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagttca
cctcccacagttgagtggcatataagcagacctgggcacatagagactttcgacctgctc
accttacacccaatagaaattgctcgacaactcactttacttgaatcagatctataccga
gctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaac
tctccgaatcttctgaaaatgattcgacataccaccaacctcactctgtggtttgagaaa
tgtattgtagaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgag
attctacaagtctttcaagagttgaacaactttaatggtgtccttgaggttgtcagtgct
atgaattcctcacctgtttacagactagaccacacatttgagcaaataccaagtcgccag
aagaaaattttagaagaagctcatgaattgagtgaagatcactataagaaatatttggca
aaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctcactaatatc
ttgaaaacagaagaaggcaaccctgaggtcctaaaaagacatggaaaagagcttataaac
tttagcaaaaggagaaaagtagcagaaataacaggagagatccagcagtaccaaaatcag
ccttactgtttacgagtagaatcagatatcaaaagattctttgaaaacttgaatccgatg
ggaaacagcatggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaa
ccacgaaaccctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatct
cctggtgttcgtccatcaaacccaagaccaggtaccatgaggcatcccacacctctgcag
caggagccaaggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagca
tctgcaccaaattctccaagaacaccgttaacacctccgcctgcttctggtgcttccagt
accacagatgtttgcagtgtatttgattccgatcattcgagcccttttcactcaagtagg
tgcaaaaattctaagtgcattaagattatgtctaagcatttggacagccccccagccatt
cctcctaggcaacccacatcaaaagcctattcaccacgatattcaatatcagaccggacc
tctatctcagaccctcctgaaagccctcccttattaccaccacgagaacctgtgaggaca
cctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaaaaaagt
gaccatggcaatgccttcttcccaaacagcccatccccctttacaccacctcctcctcaa
acaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaagaagtg
gaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaacatatc
cctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcacagagat
ggaccaccactgttggagaatgcccattcttcttga

DBGET integrated database retrieval system