KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513829
Entry
108513829         CDS       T04641                                 

Gene name
CAT
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00380  Tryptophan metabolism
rbb00630  Glyoxylate and dicarboxylate metabolism
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb04068  FoxO signaling pathway
rbb04146  Peroxisome
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108513829 (CAT)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    108513829 (CAT)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108513829 (CAT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108513829 (CAT)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    108513829 (CAT)
   04213 Longevity regulating pathway - multiple species
    108513829 (CAT)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108513829 (CAT)
   05022 Pathways of neurodegeneration - multiple diseases
    108513829 (CAT)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     108513829 (CAT)
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 108513829
NCBI-ProteinID: XP_017705208
UniProt: A0A2K6JM73
LinkDB
Position
Un
AA seq 527 aa
MADSRDPASDQMKHWKEQRAAQKADVLTTGAGNPIGDKLNVITVGSRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKRTPIAVRFSTVAGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPLLFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAEGKAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGNYPSWTFYIQVMTFNQAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIETSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPYRARVASYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSVLE
HSTQYPGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAIK
NFTEVHPDYGSRIQTLLDKYNAEKPKNAIHTFVQYESHLAAREKANL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggctgacagtcgggatcccgccagcgaccagatgaagcactggaaggagcagcgggcc
gcgcagaaagctgatgtcctgaccactggagctggtaacccaataggagacaaacttaat
gttattacagtagggtcccgtgggccccttcttgttcaggatgtggttttcactgatgaa
atggctcactttgaccgagagagaattcctgagcgagtcgtgcatgctaaaggagcaggg
gcctttggctactttgaggtcacacatgacattaccaaatattccaaggcaaaggtattt
gagcatattggaaagaggactcccatcgcagttcggttctccactgttgctggagaatcg
ggttcagctgacacagttcgggaccctcgtgggtttgcagtgaaattttacacagaagat
ggtaactgggatcttgttggaaataacacccccattttcttcatcagggatcccctattg
tttccatcttttatccacagccaaaagagaaatcctcagacgcatctgaaggatccggat
atggtctgggacttctggagcctacgtcccgagtctctgcatcaggtttctttcttgttc
agtgatcgggggattccagatggccatcgccacatgaatggatatggatcacatactttc
aagctggttaatgcagaaggaaaggcagtttattgcaaattccattataagactgaccag
ggcatcaaaaacctttctgttgaagatgcggcgagactttcccaggaagatcctgactat
ggcatccgggatctttttaatgccattgccacaggaaactacccctcctggactttttac
atccaggtcatgacatttaatcaggcagaaacttttccatttaatccatttgatcttacc
aaggtttggcctcacaaggactaccctctcatcccagttggtaaactggtcttaaaccgg
aatccagttaattactttgctgaggttgaacagatagccttcgacccaagcaacatgccc
cctggcattgagaccagccctgacaaaatgcttcagggccgcctttttgcctatcctgac
actcaccgccaccgcctgggacccaattatcttcagatacctgtgaactgtccctaccgt
gctcgagtggccagctaccagcgtgacggccccatgtgcatgcaggacaatcagggtggt
gctccaaattactaccccaacagctttggtgctccagaacaacagccttctgtcctggag
cacagcacccagtatcctggagaagtgcggagattcaacactgccaatgatgataatgtt
actcaggtgcgggcattctatgtgaacgtgctgaatgaggaacagaggaaacgtctgtgt
gagaacattgcaggccacctgaaagatgcacaaattttcatccaaaagaaagcgatcaag
aacttcactgaggtccaccctgactacgggtcccgcatccagactcttctggacaagtac
aatgctgagaagcctaagaatgcgattcacacctttgtgcagtacgagtctcacttggct
gcaagggagaaggcaaatctgtga

DBGET integrated database retrieval system