KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513939
Entry
108513939         CDS       T04641                                 

Gene name
NCF1
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04062  Chemokine signaling pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb05020  Prion disease
rbb05140  Leishmaniasis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108513939 (NCF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108513939 (NCF1)
   04670 Leukocyte transendothelial migration
    108513939 (NCF1)
   04062 Chemokine signaling pathway
    108513939 (NCF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108513939 (NCF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    108513939 (NCF1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108513939 (NCF1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108513939 (NCF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108513939 (NCF1)
Membrane trafficking [BR:rbb04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108513939 (NCF1)
SSDB
Motif
Pfam: NECFESHC p47_phox_C SH3_1 PX SH3_9 SH3_2
Other DBs
NCBI-GeneID: 108513939
NCBI-ProteinID: XP_017705397
LinkDB
Position
Un
AA seq 395 aa
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRIIPHLPAPRWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKV
RPDDLKLPTDNQTKKPETYLLPKDGKSTAAGERTTITPAIILQAYRAIATTRRPRAPEMA
LAMGGDVVEVVQKRQSGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIK
AYAAVEEDEVSLLVGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIK
RGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPSPQSPGSPLEEEPQ
TQRSKPQPAVPPRPSADLILNRCSESTRRKLASAV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggggacaccttcatccgtcacatcgccctgctgggctttgagaagcgcttcgtaccc
agccagcactatgtgtacatgtttctggtgaaatggcaggacctgtccgagaaggtggtg
taccggcgcttcaccgagatctacgagttccataaaaccttaaaagaaatgttccctatt
gaggcaggggcgatcaatccagagaacaggatcattccccaccttccagctcccaggtgg
ttcgacgggcagcgggccgccgagaaccgccagggcacgcttactgagtactgcagcaca
ctcatgagcctgcccaccaagatctcccgctgtccccacctcctcgacttcttcaaggtg
cgccccgatgacctcaagctccccacggacaaccagacaaaaaagccagagacatacttg
ctgcccaaagatggcaagagtaccgcggcaggtgagaggacaacaatcacgcccgccatc
atcctgcaagcgtaccgggccattgccactacgagaagacctcgggcacctgagatggct
ctggccatggggggggacgtggttgaggtcgtgcagaagaggcagagcggttggtggttc
tgtcagatgaaagcaaagcgaggctggatcccagcgtctttcctcgagcccctggacagt
cccgacgagacggaagaccctgagcccaactatgcaggcgagccgtacgttgccatcaag
gcctacgctgctgtggaggaggacgaggtgtccctgctcgtgggcgaagctgttgaggtc
attcacaagctcctggacggctggtgggtcatcaggaaagatgacgtcacgggctacttc
ccctccatgtacctgcaaaagtcggggcaagacgtgtcccaggcccaacgccagatcaag
cgcggggcgccgccccgcaggtcgtccatccgcaacgcgcacagcatccaccagcggtcg
cggaagcgcctcagccaggacgcctatcgccgcaacagcgtccgttttctgcagcagcgg
cgccgccaggcgcggccgtcaccgcagagccccgggagccctctggaggaggagccgcag
acccagcgctctaaaccacagccggcggtgcccccgcggcccagcgctgacctcatcctg
aaccgctgcagcgagagcaccaggcggaagctggcgtctgccgtctga

DBGET integrated database retrieval system