KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514076
Entry
108514076         CDS       T04641                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04064  NF-kappa B signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04390  Hippo signaling pathway
rbb04510  Focal adhesion
rbb04621  NOD-like receptor signaling pathway
rbb04668  TNF signaling pathway
rbb05132  Salmonella infection
rbb05145  Toxoplasmosis
rbb05168  Herpes simplex virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108514076 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108514076 (BIRC2)
   04064 NF-kappa B signaling pathway
    108514076 (BIRC2)
   04668 TNF signaling pathway
    108514076 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108514076 (BIRC2)
   04215 Apoptosis - multiple species
    108514076 (BIRC2)
   04217 Necroptosis
    108514076 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108514076 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108514076 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514076 (BIRC2)
   05202 Transcriptional misregulation in cancer
    108514076 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108514076 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108514076 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108514076 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108514076 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108514076 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108514076 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108514076 (BIRC2)
Peptidases and inhibitors [BR:rbb01002]
 Peptidase inhibitors
  Family I32: IAP family
   108514076 (BIRC2)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108514076 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 108514076
NCBI-ProteinID: XP_017705591
LinkDB
Position
Un
AA seq 657 aa
MGRRASGAPELIRAEAAVSPCLYRCFPALGRPLGCRAASVFAAPALRLFPGPSYQNIKSI
MEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKLGDSPIEKHKQLYPSCSFIQNLVSATLVSTSKNTSPMRNSFAHSLSP
TLEHSSLFSGSYSSLSPNPLNSRAVEDFSPSRTNPYSYAMSTEEARFLTYHMWPLTFLSP
SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSI
SNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDD
PWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGDENADPPIIHFGPG
ESSSEDAVMMNTPVVKSALEMGFSRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEK
REEEKERQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQ
IPLQARELIDTVLVKGNAAANIFKNCVKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQ
LRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
NT seq 1974 nt   +upstreamnt  +downstreamnt
atggggcggcgggcttcgggagcgccggagctgatccgagccgaggcggccgtatctcct
tgtctgtaccgctgcttcccggctctggggaggcctctaggctgccgcgcagcttccgtg
tttgctgctcccgcactgcgacttttcccaggtccctcgtatcaaaacattaagagtata
atggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaagtat
gacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggttcct
gtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctattgaa
aagcataaacaactatatcctagctgtagctttattcagaatctggtttcagctactctg
gtatccacctctaagaatacttctccaatgagaaacagttttgcacattcattatctccc
accttggaacatagtagcttgttcagtggttcttactccagcctttcaccaaaccctctt
aattctagagcagttgaagacttctctccatcgaggactaacccctacagttatgcaatg
agtactgaagaagcccgatttcttacctaccatatgtggccattaacttttttgtcaccg
tcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgcttt
gcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacaccgg
agacactttcccaactgtccatttttggaaaattctctggaaacgctgaggtttagcatt
tcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtattggccatcc
agtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgcaat
gatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagatgat
ccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaaggt
caagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttgtca
acttcggatactactggagatgaaaatgctgacccaccaattattcattttggacccgga
gaaagttcttcagaagatgccgtcatgatgaatacacctgtggttaaatctgccttggaa
atgggctttagtagagacctggtaaaacaaacagttcaaagtaaaatcctgacaactgga
gagaactacaaaacagttaatgatattgtatcagcacttcttaatgctgaagatgaaaaa
agagaagaggagaaggaaagacaagctgaagaaatggcatcagatgatttgtcattaatt
cggaagaatagaatggctctctttcaacagttgacgtgtgtgcttcctattttggataat
cttttgaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaacacag
atacctttacaagcgagagaactgattgataccgttttggttaaaggaaatgctgcagcc
aacatcttcaaaaactgtgtaaaagaaattgactctacattgtataagaacttatttgtg
gataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaacaa
ttgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttctatt
gtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaagaaaa
tgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514077
Entry
108514077         CDS       T04641                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04064  NF-kappa B signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04390  Hippo signaling pathway
rbb04510  Focal adhesion
rbb04621  NOD-like receptor signaling pathway
rbb04668  TNF signaling pathway
rbb05132  Salmonella infection
rbb05145  Toxoplasmosis
rbb05168  Herpes simplex virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108514077 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108514077 (BIRC3)
   04064 NF-kappa B signaling pathway
    108514077 (BIRC3)
   04668 TNF signaling pathway
    108514077 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108514077 (BIRC3)
   04215 Apoptosis - multiple species
    108514077 (BIRC3)
   04217 Necroptosis
    108514077 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108514077 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108514077 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514077 (BIRC3)
   05202 Transcriptional misregulation in cancer
    108514077 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108514077 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108514077 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108514077 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108514077 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108514077 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108514077 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108514077 (BIRC3)
Peptidases and inhibitors [BR:rbb01002]
 Peptidase inhibitors
  Family I32: IAP family
   108514077 (BIRC3)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108514077 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX OTT_1508_deam
Other DBs
NCBI-GeneID: 108514077
NCBI-ProteinID: XP_017705596
UniProt: A0A2K6JXP8
LinkDB
Position
Un
AA seq 604 aa
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPVEKHKKLYPSCRFVQSLNSVNNSEATSQPTFPSSVTSS
THSLLPGTENSGYFSGSYSSFPSNPVNSRANQDFSALMRSSYHCAMNNEKARLLTFQTWP
LTFLSPTDLAKAGFYYVGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFICQVQASYPHLLEQLLSTSDSPEDENAESS
IIHFEPGEDHSEDAIMMNTPVVNAAVEMGFSRSLVKHTVQRKILATGDNYRLVSDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTARIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEADAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaatagcatattcttatcaaatttgatgaaaagtgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgcgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgcggcctgatgctagataactggaaaagaggagac
agtcctgttgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tcagttaacaactcagaagctacctctcagcctacttttccttcttcagtaacaagttcc
acacattcattacttccgggtacagaaaacagtggatatttcagtggctcttattcaagc
tttccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataatgaaaaagccagattacttacttttcagacgtggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacgttggacctgga
gacagagtggcttgctttgcctgtggtggaaaactgagcaattgggaaccgaaggataat
gcaatgtcagaacacctgagacattttcccaaatgcccatttatcgaaaatcagcttcaa
gacacttcgagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcaggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggtggaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatctgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatctacatcagacagcccagaagatgaaaatgcagagtcatca
attattcattttgaacctggagaagaccattcagaagacgcaatcatgatgaatactcct
gtggttaatgctgccgtggaaatgggctttagtagaagcctggtaaaacacacagttcag
agaaaaatcctagcaactggagacaattatagactcgtcagtgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccagaattattaatgaacaagaacatgat
gttattaaacagaagacacagacatctttacaagcaagagaactgattgatactatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgatgctgtg
ttatatgagcatttatttgtacaacaggacataaagtatattcccacagaagatgtttcg
gatctaccagtggaagaacagttgcggagattacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgcaggagtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535289
Entry
108535289         CDS       T04641                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat containing 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04215  Apoptosis - multiple species
rbb05145  Toxoplasmosis
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108535289 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108535289 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535289 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108535289 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108535289 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108535289 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108535289 (BIRC7)
Peptidases and inhibitors [BR:rbb01002]
 Peptidase inhibitors
  Family I32: IAP family
   108535289 (BIRC7)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108535289 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-C3HC4_2 DUF2039 zf-RING_2 zf-RING_UBOX TerY_C ArfGap
Other DBs
NCBI-GeneID: 108535289
NCBI-ProteinID: XP_017736702
UniProt: A0A2K6N6L4
LinkDB
Position
Un
AA seq 298 aa
MGPEDSAKCLRHGPQLSRWVAGDRPAQERCGPRSLGSPALGLDTCRAWDHVDGQILGQLR
PLAEEEEEEGAGATSPRGPAFPGMGSEELRLASFYDWPLTAGVPPELLAAAGFFHTGQQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPAPGDPELPTPRREVQSESAQEPGGASPAQAQSGWWVLEPPGARDAE
EQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPSLQLCPICRAPIRSRVRTFLS
NT seq 897 nt   +upstreamnt  +downstreamnt
atggggcctgaagacagtgccaagtgcctgcgccatggaccacagctgagccgctgggta
gccggtgaccgtcccgcgcaggagcgctgtggaccccgctctctgggcagccctgcccta
ggcctggacacttgcagagcctgggaccatgtggatgggcagatcctgggccagctgcgg
cccctggcagaggaggaagaggaggagggcgccggggccacgtcgcccagggggcctgcc
ttccctggcatgggctctgaagagctgcgtctggcctccttctatgactggccgctgacg
gctggggtgccgcccgagctgctggccgctgctggctttttccacacaggccagcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcattcccagctgctgggctcctgggacccgtgg
gaagaaccggaagatgcagcccctgtggccccctccgtccctgcccctggggaccctgag
ctgcccacgccgagaagagaggtccagtctgaaagtgcccaggagccaggaggagccagt
ccagcccaggcccagagcgggtggtgggttcttgagcccccaggagccagggatgcggag
gagcagctgcgacggctgcaggaggagaggacttgcaaggtgtgcctggaccgtgccgtg
tccatcgtctttgtgccatgcggccacctggtctgtgctgagtgtgcccccagcctgcag
ctgtgccccatctgcagagcccccatccgcagccgtgtgcgcaccttcctgtcctag

DBGET integrated database retrieval system