KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514304
Entry
108514304         CDS       T04641                                 

Gene name
GABARAP
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04371  Apelin signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04727  GABAergic synapse
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108514304 (GABARAP)
   04068 FoxO signaling pathway
    108514304 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108514304 (GABARAP)
   04136 Autophagy - other
    108514304 (GABARAP)
   04137 Mitophagy - animal
    108514304 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108514304 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    108514304 (GABARAP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108514304 (GABARAP)
   05022 Pathways of neurodegeneration - multiple diseases
    108514304 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108514304 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108514304 (GABARAP)
   04121 Ubiquitin system [BR:rbb04121]
    108514304 (GABARAP)
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108514304 (GABARAP)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108514304 (GABARAP)
Ubiquitin system [BR:rbb04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108514304 (GABARAP)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108514304 (GABARAP)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 108514304
NCBI-ProteinID: XP_017705906
LinkDB
Position
Un
AA seq 101 aa
MDPGYLNKLQSVRSGSLVLSAAPRVQKQRDESGVIVEKAPKARIGDLDKKKYLVPSDLTV
GQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQVW
NT seq 306 nt   +upstreamnt  +downstreamnt
atggatcctggatatttaaataagctccagtcagtgaggtcaggatctctggtactcagt
gctgcaccgcgtgtacaaaaacaaagagatgagtctggggtgatagtagaaaaggctccc
aaagctcggataggagacctggacaaaaagaaatacctggtgccttctgatctcacagtt
ggtcagttctacttcttgatccggaagcgaattcatctccgagctgaggatgccttgttt
ttctttgtcaacaatgtcattccacccaccagtgccacaatgggtcagctctaccaggta
tggtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517211
Entry
108517211         CDS       T04641                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 3
  KO
K08341  GABA(A) receptor-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04371  Apelin signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04727  GABAergic synapse
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108517211
   04068 FoxO signaling pathway
    108517211
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108517211
   04136 Autophagy - other
    108517211
   04137 Mitophagy - animal
    108517211
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108517211
  09156 Nervous system
   04727 GABAergic synapse
    108517211
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108517211
   05022 Pathways of neurodegeneration - multiple diseases
    108517211
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108517211
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108517211
   04121 Ubiquitin system [BR:rbb04121]
    108517211
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108517211
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108517211
Ubiquitin system [BR:rbb04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108517211
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108517211
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 108517211
NCBI-ProteinID: XP_017710478
LinkDB
Position
Un
AA seq 117 aa
MNFQYKEDHPFEYRKREAENIRKKHPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTNGQF
YFLIRKRIHLRPEGALFFFVNNTIPPTSATVGHLYEDSHEEDDFLYVAYSNESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaatttccagtacaaagaggaccatccctttgagtatcggaaaagggaagcagaaaat
atccggaagaaacatccggacagggtccctgtgattgtagagaaggctccaaaagccagg
gtgcctgatctggacaagaggaagtacctagtgccctccgaccttaccaatggccagttc
tacttcttaatccggaagagaatccacctgagacctgagggcgccttattcttctttgtc
aacaacacaatccctcccactagtgctaccgtgggccatctgtatgaggacagtcatgag
gaagatgattttctgtatgtggcctacagtaatgagagtgtctatgggaaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527415
Entry
108527415         CDS       T04641                                 

Gene name
GABARAPL2
Definition
(RefSeq) GABA type A receptor associated protein like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04371  Apelin signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04727  GABAergic synapse
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108527415 (GABARAPL2)
   04068 FoxO signaling pathway
    108527415 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108527415 (GABARAPL2)
   04136 Autophagy - other
    108527415 (GABARAPL2)
   04137 Mitophagy - animal
    108527415 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108527415 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    108527415 (GABARAPL2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108527415 (GABARAPL2)
   05022 Pathways of neurodegeneration - multiple diseases
    108527415 (GABARAPL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108527415 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108527415 (GABARAPL2)
   04121 Ubiquitin system [BR:rbb04121]
    108527415 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108527415 (GABARAPL2)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108527415 (GABARAPL2)
Ubiquitin system [BR:rbb04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108527415 (GABARAPL2)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108527415 (GABARAPL2)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 108527415
NCBI-ProteinID: XP_017724168
UniProt: A0A2K6M6T7
LinkDB
Position
Un
AA seq 124 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGHALREGKKMKMDYLYVAYSGENHFWLLR
AIAG
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactcgctggaacacagatgcgtggagtccgcaaag
attcgagcgaaatatcccgacagggttccggtgattgtggaaaaggtctcaggctctcag
attgttgacattgacaaacggaagtacttggttccatctgatatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccttctgaaaaggcgatcttcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacacgctttacgagaaggaaaaaag
atgaagatggattacttgtatgtggcctacagcggagagaaccacttttggcttctgagg
gccattgctggctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542138
Entry
108542138         CDS       T04641                                 

Gene name
GABARAPL1
Definition
(RefSeq) GABA type A receptor associated protein like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04371  Apelin signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04727  GABAergic synapse
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108542138 (GABARAPL1)
   04068 FoxO signaling pathway
    108542138 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108542138 (GABARAPL1)
   04136 Autophagy - other
    108542138 (GABARAPL1)
   04137 Mitophagy - animal
    108542138 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108542138 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    108542138 (GABARAPL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108542138 (GABARAPL1)
   05022 Pathways of neurodegeneration - multiple diseases
    108542138 (GABARAPL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108542138 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108542138 (GABARAPL1)
   04121 Ubiquitin system [BR:rbb04121]
    108542138 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108542138 (GABARAPL1)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108542138 (GABARAPL1)
Ubiquitin system [BR:rbb04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108542138 (GABARAPL1)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108542138 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 108542138
NCBI-ProteinID: XP_017747496
UniProt: A0A2K6LXS1
LinkDB
Position
Un
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtacaaggaggaccatcccttcgagtatcggaaaaaggaaggagaaaag
atccggaagaaatatccggacagggtccccgtgattgtagagaaggctccaaaagccagg
gtgcctgatctggacaagaggaagtacctagtgccctctgaccttaccgttggccagttc
tacttcttaatccggaagagaatccacctgagacctgaggacgccttattcttctttgtc
aacaacactatccctcccaccagtgctaccatgggccaactgtatgaggacaatcatgag
gaagactattttctgtatgtggcctacagtgatgagagtgtctatgggaaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108545090
Entry
108545090         CDS       T04641                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04371  Apelin signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04727  GABAergic synapse
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108545090
   04068 FoxO signaling pathway
    108545090
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108545090
   04136 Autophagy - other
    108545090
   04137 Mitophagy - animal
    108545090
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108545090
  09156 Nervous system
   04727 GABAergic synapse
    108545090
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108545090
   05022 Pathways of neurodegeneration - multiple diseases
    108545090
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108545090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108545090
   04121 Ubiquitin system [BR:rbb04121]
    108545090
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108545090
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108545090
Ubiquitin system [BR:rbb04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108545090
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108545090
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 108545090
NCBI-ProteinID: XP_017752047
LinkDB
Position
Un
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccgttcgagaaacgccgctctgagggcgagaaa
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcagctctaccaggaacaccatgaa
gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga

DBGET integrated database retrieval system