KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514363
Entry
108514363         CDS       T04641                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04010  MAPK signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04137  Mitophagy - animal
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04216  Ferroptosis
rbb04218  Cellular senescence
rbb04310  Wnt signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108514363 (TP53)
   04310 Wnt signaling pathway
    108514363 (TP53)
   04071 Sphingolipid signaling pathway
    108514363 (TP53)
   04151 PI3K-Akt signaling pathway
    108514363 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108514363 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    108514363 (TP53)
   04210 Apoptosis
    108514363 (TP53)
   04216 Ferroptosis
    108514363 (TP53)
   04115 p53 signaling pathway
    108514363 (TP53)
   04218 Cellular senescence
    108514363 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108514363 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108514363 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    108514363 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514363 (TP53)
   05202 Transcriptional misregulation in cancer
    108514363 (TP53)
   05206 MicroRNAs in cancer
    108514363 (TP53)
   05205 Proteoglycans in cancer
    108514363 (TP53)
   05203 Viral carcinogenesis
    108514363 (TP53)
   05230 Central carbon metabolism in cancer
    108514363 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108514363 (TP53)
   05212 Pancreatic cancer
    108514363 (TP53)
   05225 Hepatocellular carcinoma
    108514363 (TP53)
   05226 Gastric cancer
    108514363 (TP53)
   05214 Glioma
    108514363 (TP53)
   05216 Thyroid cancer
    108514363 (TP53)
   05220 Chronic myeloid leukemia
    108514363 (TP53)
   05217 Basal cell carcinoma
    108514363 (TP53)
   05218 Melanoma
    108514363 (TP53)
   05219 Bladder cancer
    108514363 (TP53)
   05215 Prostate cancer
    108514363 (TP53)
   05213 Endometrial cancer
    108514363 (TP53)
   05224 Breast cancer
    108514363 (TP53)
   05222 Small cell lung cancer
    108514363 (TP53)
   05223 Non-small cell lung cancer
    108514363 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108514363 (TP53)
   05014 Amyotrophic lateral sclerosis
    108514363 (TP53)
   05016 Huntington disease
    108514363 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108514363 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108514363 (TP53)
   05161 Hepatitis B
    108514363 (TP53)
   05160 Hepatitis C
    108514363 (TP53)
   05162 Measles
    108514363 (TP53)
   05168 Herpes simplex virus 1 infection
    108514363 (TP53)
   05163 Human cytomegalovirus infection
    108514363 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108514363 (TP53)
   05169 Epstein-Barr virus infection
    108514363 (TP53)
   05165 Human papillomavirus infection
    108514363 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108514363 (TP53)
   01522 Endocrine resistance
    108514363 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108514363 (TP53)
   03036 Chromosome and associated proteins [BR:rbb03036]
    108514363 (TP53)
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108514363 (TP53)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    108514363 (TP53)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108514363 (TP53)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108514363 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 108514363
NCBI-ProteinID: XP_017706033
LinkDB
Position
Un
AA seq 412 aa
MLDPHFSPCSSQTALRVTAMEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVD
DLMLSPDDLAQWLTEDPGPDEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQK
TYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMA
IYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYE
PPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRD
RRTEEENYRKKGEPCHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMF
RELNEALELKDAQAGKEPAGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgctggatccccacttttccccttgcagcagccagactgccttgcgggtcactgccatg
gaggagccacagtcagatcctagcatcgagccccctctgagtcaggaaacattttcagac
ctttggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcggtggat
gacttgatgctgtctccggacgatcttgcacaatggttaactgaagacccaggtccagat
gaagctcccagaatgtcagaggctgctccccccatggcccccacaccagcagctcctaca
ccggcagcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccagaaa
acctaccatggcagctatggtttccgtctgggcttcctgcattctggaacagccaagtct
gtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacctgt
cctgtgcagctgtgggttgattccacacccccgcccggcagccgcgttcgtgccatggcc
atctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgagcgc
tgctcagacagcgatggactggcccctcctcagcatcttatccgagtggaaggaaatttg
cgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctatgag
ccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagttcc
tgcatgggcggcatgaatcggaggcccattctcaccatcatcacactggaagactccagt
ggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggagagac
cggcgcacagaggaagagaattaccgcaagaaaggggagccttgccacgagctgccccct
gggagcactaagcgagcactgcccaacaacaccagctcctctccgcagccaaagaagaaa
ccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatgttc
cgagaactgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcgggg
agcagggctcactccagccacctgaagtccaagaaggggcagtctacctcccgccataaa
aaactcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system