KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514611
Entry
108514611         CDS       T04641                                 

Gene name
ITGA5
Definition
(RefSeq) integrin subunit alpha 5
  KO
K06484  integrin alpha 5
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04640  Hematopoietic cell lineage
rbb04810  Regulation of actin cytoskeleton
rbb05100  Bacterial invasion of epithelial cells
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05165  Human papillomavirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108514611 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108514611 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108514611 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108514611 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108514611 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108514611 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108514611 (ITGA5)
   05205 Proteoglycans in cancer
    108514611 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108514611 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108514611 (ITGA5)
   05414 Dilated cardiomyopathy
    108514611 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108514611 (ITGA5)
   05133 Pertussis
    108514611 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    108514611 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108514611 (ITGA5)
   05165 Human papillomavirus infection
    108514611 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108514611 (ITGA5)
   04515 Cell adhesion molecules [BR:rbb04515]
    108514611 (ITGA5)
   04090 CD molecules [BR:rbb04090]
    108514611 (ITGA5)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108514611 (ITGA5)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108514611 (ITGA5)
CD molecules [BR:rbb04090]
 Proteins
  108514611 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 108514611
NCBI-ProteinID: XP_017706421
LinkDB
Position
Un
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNFDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDVGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECLRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagagtcccctctccac
gccgtgcagctgcgctggggcccccggcgccgacccccgctgctgccgctgctgctgctg
ctgctgccgccgccacccagggtcgggggcttcaactttgacgcggaggccccagcagtg
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctggtgggagcgcccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggtgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgcgctccactgtacagctggcgcacagagaaggagccactcagcgac
cctgtgggtacctgctacctctccacagataacttcacccgaattctggagtatgcacct
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgct
gagttcactaagactggtcgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttactaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctacttcggctatgcagtggct
gccacagacatcaatggggacgggctggatgacttgctggtgggggcaccgctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacgtctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggccatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
attggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccaggttctgcaacccctgtgggcagccagtcac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacaggggccgcccc
atcgtgtctgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaatgagtcagaatttcgagacaaactctccccgattcacatcgctctcaacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctacattaccagagt
aagagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaagtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctgaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtgaccgcccctccagaggctgagtactcaggactcgtcagacatccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagcgacgtggtttccttccggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacgtgggacctgctgtgcaccatgtctatgag
ctcatcaaccaaggccccagctccattagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttacgggactcaactgcaccacc
aatcaccccattaacccaaagggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctctggacctcagatcctgaaatgc
ccggaggctgagtgtttgaggctgcgctgcgagctcgggcccctgcaccaacaagagagc
caaagtctgcagctgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcggcagctgccccaaaaggagcgtcaggtggccacagctgtgcaatggaccaaggca
gaaggcagctatggtgtcccactgtggatcatcatcctagccatcctttttggcctcctg
ctactaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

DBGET integrated database retrieval system