KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514714
Entry
108514714         CDS       T04641                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04144  Endocytosis
rbb04218  Cellular senescence
rbb04310  Wnt signaling pathway
rbb04350  TGF-beta signaling pathway
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04520  Adherens junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04659  Th17 cell differentiation
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108514714 (SMAD3)
   04350 TGF-beta signaling pathway
    108514714 (SMAD3)
   04390 Hippo signaling pathway
    108514714 (SMAD3)
   04371 Apelin signaling pathway
    108514714 (SMAD3)
   04068 FoxO signaling pathway
    108514714 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108514714 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    108514714 (SMAD3)
   04218 Cellular senescence
    108514714 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108514714 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    108514714 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108514714 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514714 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108514714 (SMAD3)
   05212 Pancreatic cancer
    108514714 (SMAD3)
   05225 Hepatocellular carcinoma
    108514714 (SMAD3)
   05226 Gastric cancer
    108514714 (SMAD3)
   05220 Chronic myeloid leukemia
    108514714 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108514714 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108514714 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108514714 (SMAD3)
   05161 Hepatitis B
    108514714 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 108514714
NCBI-ProteinID: XP_017706604
UniProt: A0A2K6K5G6
LinkDB
Position
Un
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNA
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggtgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaagaagacggggcaactggacgagctggagaaggccatcaccacgcagaacgcc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccggacctgcacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaagtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctgtccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcacagccatccatgactgtggacggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacgcggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgctgccctcctggcccagtctgtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgtaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccttgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519603
Entry
108519603         CDS       T04641                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04110  Cell cycle
rbb04144  Endocytosis
rbb04218  Cellular senescence
rbb04350  TGF-beta signaling pathway
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04659  Th17 cell differentiation
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05142  Chagas disease
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108519603 (SMAD2)
   04390 Hippo signaling pathway
    108519603 (SMAD2)
   04371 Apelin signaling pathway
    108519603 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108519603 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    108519603 (SMAD2)
   04218 Cellular senescence
    108519603 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108519603 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108519603 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108519603 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108519603 (SMAD2)
   05205 Proteoglycans in cancer
    108519603 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108519603 (SMAD2)
   05212 Pancreatic cancer
    108519603 (SMAD2)
   05225 Hepatocellular carcinoma
    108519603 (SMAD2)
   05226 Gastric cancer
    108519603 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108519603 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108519603 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519603 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108519603 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 108519603
NCBI-ProteinID: XP_017714230
UniProt: A0A2K6KLL7
LinkDB
Position
Un
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaagaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagcttaagaaaacaggacgattagatgag
cttgagaaagccatcaccacgcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacacactgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattatattccagaaacg
ccgcctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggctctccagcagaactatctcctactactctttcccctgttaatcatagc
ttggacttacagccagttacttactcagaacctgcgttttggtgttcaatagcatattat
gaattaaatcagagagttggagaaaccttccatgcatcacaaccctcactcactgtagat
ggctttacagatccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgccacagtagaaatgacaagaaggcatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggttggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgtgaatcag
ggttttgaagccgtctaccagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system