KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514790
Entry
108514790         CDS       T04641                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04620  Toll-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04940  Type I diabetes mellitus
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05162  Measles
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05321  Inflammatory bowel disease
rbb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108514790 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108514790 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108514790 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    108514790 (IL12A)
   04625 C-type lectin receptor signaling pathway
    108514790 (IL12A)
   04658 Th1 and Th2 cell differentiation
    108514790 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514790 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108514790 (IL12A)
   05330 Allograft rejection
    108514790 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108514790 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108514790 (IL12A)
   05134 Legionellosis
    108514790 (IL12A)
   05152 Tuberculosis
    108514790 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108514790 (IL12A)
   05164 Influenza A
    108514790 (IL12A)
   05162 Measles
    108514790 (IL12A)
   05168 Herpes simplex virus 1 infection
    108514790 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108514790 (IL12A)
   05144 Malaria
    108514790 (IL12A)
   05145 Toxoplasmosis
    108514790 (IL12A)
   05140 Leishmaniasis
    108514790 (IL12A)
   05142 Chagas disease
    108514790 (IL12A)
   05143 African trypanosomiasis
    108514790 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108514790 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108514790 (IL12A)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108514790 (IL12A)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108514790 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 108514790
NCBI-ProteinID: XP_017706783
UniProt: A0A2K6M9K6
LinkDB
Position
Un
AA seq 253 aa
MWPPGSASQPPPSPATATGLHPAARPVSLQCQLSMCPARSLLLVATLVLLDYLSLARNLS
VATPVPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACL
PLELIKNESCLNSRETSFTTNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLGVIDELMQALNFSSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcgcagccaccgccctcacctgccacggccacaggtctg
catccagcggctcgcccagtgtccctgcagtgccagctcagcatgtgtccagcgcgcagc
ctcctccttgtggccaccctggtcctcctggactacctcagtttggccagaaacctctcc
gtggccaccccagtcccagaaatgttcccatgccttcaccactcccaaaacctgctgaag
gccgccagcaacacgctccagaaggccagacaaattctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaatcaagaatgagagttgcctaaattccagagagacctctttcacaact
aatgggagttgcttggcttccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctgggcgttattgacgagctg
atgcaggccctgaatttcagcagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttacaaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537933
Entry
108537933         CDS       T04641                                 

Gene name
IL12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04620  Toll-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04940  Type I diabetes mellitus
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05162  Measles
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05321  Inflammatory bowel disease
rbb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108537933 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108537933 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108537933 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    108537933 (IL12B)
   04625 C-type lectin receptor signaling pathway
    108537933 (IL12B)
   04658 Th1 and Th2 cell differentiation
    108537933 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108537933 (IL12B)
   05205 Proteoglycans in cancer
    108537933 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108537933 (IL12B)
   05330 Allograft rejection
    108537933 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108537933 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108537933 (IL12B)
   05134 Legionellosis
    108537933 (IL12B)
   05152 Tuberculosis
    108537933 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108537933 (IL12B)
   05164 Influenza A
    108537933 (IL12B)
   05162 Measles
    108537933 (IL12B)
   05168 Herpes simplex virus 1 infection
    108537933 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108537933 (IL12B)
   05145 Toxoplasmosis
    108537933 (IL12B)
   05140 Leishmaniasis
    108537933 (IL12B)
   05142 Chagas disease
    108537933 (IL12B)
   05143 African trypanosomiasis
    108537933 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108537933 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108537933 (IL12B)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108537933 (IL12B)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108537933 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_2 Ig_5 Ig_3 fn3 Ig_4 I-set
Other DBs
NCBI-GeneID: 108537933
NCBI-ProteinID: XP_017741189
UniProt: A0A2K6K365
LinkDB
Position
Un
AA seq 328 aa
MCHQQLVISWFSLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSIKSSRGSSNPQGVTCGAPTLSPERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVIC
RKNASFSVQAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagctggtcatctcttggttttccctggtttttctggcatctcccctc
atggccatatgggaactgaagaaagacgtttatgttgtagaattggattggtacccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagtggtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggctctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaagccaaaaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatctgacattcagtatcaaaagcagcaga
ggctcttctaacccccaaggggtgacgtgcggagcccctacactctctccagagagggtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gccgctgaggagaggctgcctattgaggtcatggtggatgccattcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacccgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcattcaggtccagggcaag
agcaagagagaaaagaaagatagaatcttcacagacaagacctcagccacggtcatctgc
cgcaaaaatgccagctttagcgtgcaggcccaggaccgctactacagctcatcttggagc
gaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system