KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514897
Entry
108514897         CDS       T04641                                 

Gene name
SIRT1
Definition
(RefSeq) sirtuin 1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00760  Nicotinate and nicotinamide metabolism
rbb01100  Metabolic pathways
rbb04068  FoxO signaling pathway
rbb04152  AMPK signaling pathway
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04922  Glucagon signaling pathway
rbb05031  Amphetamine addiction
rbb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    108514897 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108514897 (SIRT1)
   04152 AMPK signaling pathway
    108514897 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108514897 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108514897 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    108514897 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    108514897 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108514897 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    108514897 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108514897 (SIRT1)
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108514897 (SIRT1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     108514897 (SIRT1)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     108514897 (SIRT1)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108514897 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 108514897
NCBI-ProteinID: XP_017706931
LinkDB
Position
Un
AA seq 743 aa
MADEAALALQPGGSPXGGGAEREAASPPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAGGCPVAAAALWREAEAAAAGGEEEAQATAAAGEGDNGPGLQGPSREPPLADSFYNED
DDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGP
YTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIE
DAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRK
DPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHG
SFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHR
AMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDV
IINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSDLPPTPLHISEDSSSPERT
SPPDSSVIVTLLDQAAKSNDDLDVSESKGLMEEKPQEVQNSRNVESIAEQMGNPDLKNVG
SSTGEKNERTSVAGTVRKCWPSRVAKEQISKRLDGNQYLFLPPNRYIFHGAEVYSDSEDD
VLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQ
EAINEAISMKQEVTDMNYPSNKS
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggcggacgaggcggccctcgcccttcagcccggcggctcccctnncggcggcggggcc
gagagggaggccgcgtcgccccccgccggggagccgctccgcaagaggccgcggagagat
ggtcccggcctcgagcggagcccgggcgagcccggtggggcagccccagagcgtgaggtg
ccggcggccgggggctgcccggtggcggcggcggcgctgtggcgggaggcagaggcggcg
gcggcaggcggggaggaagaggcccaggcgactgcggcggctggggaaggagacaatggg
ccgggcctgcagggcccatctcgggagccaccgctggccgacagcttctacaacgaagac
gacgacgacgagggcgaggaggaggaagaggcggcggcggcggcgattgggtatcgagat
aaccttctgttcggtgatgaaattatcactaatggttttcattcttgtgaaagtgatgag
gaggatagagcctcacatgcaagctctagtgactggactccaaggccacggataggtcca
tatacttttgttcagcaacatcttatgattggcacagatcctcgaacaatccttaaagat
ttattgccggaaacaattcctccacctgagttggatgatatgacactgtggcagattgtt
attaatatcctttcagaaccaccaaaaaggaaaaaaagaaaagatattaatacaattgaa
gatgctgtgaaattactgcaagagtgcaaaaaaattatagttctaactggagctggggtg
tctgtttcatgtggaatacctgacttcaggtcaagggatggtatttatgctcgccttgct
gtagacttcccagatcttccagatcctcaagcgatgtttgatattgaatatttcagaaaa
gatccaagaccattcttcaagtttgcaaaggaaatatatcctggacaattccaaccatct
ctctgtcacaaattcatagccttgtcagataaggaaggaaaactacttcgcaactatacg
cagaacatagacacgctggaacaggttgcgggaatccagaggataattcagtgtcatggt
tcctttgcaacagcatcttgcctgatttgtaaatacaaagttgactgtgaagctgtacga
ggagatatttttaatcaggtagttcctcgatgtcctaggtgcccagctgatgaaccgctt
gctatcatgaaaccagagattgtgttttttggtgaaaatttaccagaacagtttcataga
gccatgaagtatgacaaagatgaagttgacctcctcattgttattgggtcttccctcaaa
gtaagaccggtagcactaattccaagttccataccccatgaagtgcctcagatattaatt
aatagagaacctttgcctcatctgcattttgatgtagaacttcttggagactgtgatgtc
ataattaatgaattgtgtcataggttaggtggtgaatatgccaaactttgctgtaaccct
gtaaagctttcagaaattactgaaaaacccccacgaacacaaaaagaattggcttatttg
tcagacttgccacccacacctcttcatatttcagaagactcaagttcaccagaaagaact
tcaccaccagattcttcagtgattgtcacacttttagaccaagcagctaagagtaatgat
gatttagatgtgtctgaatcaaaaggtcttatggaagaaaaaccacaggaagtacagaat
tctaggaatgttgaaagtattgctgaacagatgggaaatccggatttgaagaatgttggt
tccagtactggggagaaaaatgaaagaacttcagtggctggaacagtgagaaaatgctgg
cctagtagagtggcaaaggagcagattagtaagcggcttgatggtaatcagtatctgttt
ttgccaccaaatcgttacattttccatggcgctgaggtatattcagactcggaagatgac
gtcttatcctctagttcttgtggcagtaacagtgatagtgggacatgccagagtccaagt
ttagaagaacccatggaagatgaaagtgaaattgaagaattctacaatggcttagaagat
gagcctgatgttccagagagagctggaggagctggatttgggactgatggagatgatcaa
gaggcaattaatgaagctatatctatgaaacaggaagtaacagacatgaactatccatca
aacaaatcatag

DBGET integrated database retrieval system