KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514953
Entry
108514953         CDS       T04641                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04064  NF-kappa B signaling pathway
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04668  TNF signaling pathway
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108514953 (TRAF3)
   04668 TNF signaling pathway
    108514953 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108514953 (TRAF3)
   04621 NOD-like receptor signaling pathway
    108514953 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    108514953 (TRAF3)
   04657 IL-17 signaling pathway
    108514953 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514953 (TRAF3)
   05203 Viral carcinogenesis
    108514953 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108514953 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108514953 (TRAF3)
   05160 Hepatitis C
    108514953 (TRAF3)
   05171 Coronavirus disease - COVID-19
    108514953 (TRAF3)
   05164 Influenza A
    108514953 (TRAF3)
   05162 Measles
    108514953 (TRAF3)
   05168 Herpes simplex virus 1 infection
    108514953 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108514953 (TRAF3)
   05169 Epstein-Barr virus infection
    108514953 (TRAF3)
   05165 Human papillomavirus infection
    108514953 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin Sina zf-C3HC4_2 Tropomyosin_1 MPS2 Spc7 Spc29 zf-RING_4 Cast zf-C3HC4_3 T3SSipB KxDL FliJ zf-RING_UBOX BLOC1_2 Fib_alpha DUF1664 DUF3450 SPATA24 GAS V_ATPase_I
Other DBs
NCBI-GeneID: 108514953
NCBI-ProteinID: XP_017706983
LinkDB
Position
Un
AA seq 538 aa
MTHRSAWLLHGIQKTKTREARFYTTIWKHLIYALELLLFPKMESSKKMDSPGSLQTNPPL
KLHTDRSAGMPIFAPEQGGYKEKFVKTVEDKYKCEKCRLVLCSPKQTECGHRFCESCMAA
LLSSSSPKCTACQESIVKDKVFFLLTCEDQGDKDLTLWESKHEDTDCPCVVVSCPHKCSV
QALLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSL
EKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKL
KELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQ
MLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYF
GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD
AFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgacacacagaagtgcatggctattgcatggtatccagaaaacaaagaccagagaagcc
agattttataccaccatctggaaacatttaatttatgctttagaactcctcctctttcct
aaaatggagtcgagtaaaaagatggactcccctggctcgctgcagactaacccgccgcta
aagctgcacactgaccgcagtgctgggatgccgatttttgcccccgaacaaggaggttac
aaggaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgtcgcctggtg
ctgtgcagcccgaagcagactgaatgtgggcaccgcttctgcgagagctgcatggccgcc
ctgctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataag
gtattctttctgttaacttgtgaagatcagggtgataaagatctcaccctatgggagagt
aaacatgaggacaccgactgtccctgcgtggtggtatcctgccctcacaaatgcagcgtc
caggctctcctgaggagcgagttgagtgcacacttgtcagagtgtgtcaatgcccccagc
acctgtagttttaagcgctatggctgcgtttttcaggggacaaaccagcagatcaaggcc
cacgaggccagctccgccgtgcagcacgtcaacctgctgaaggagtggagcaactcgctc
gaaaagaaggtttccttgttgcagaatgaaagtgtagaaaaaaacaagagcatacaaagt
ttgcacaatcagatatgtagctttgaaattgaaattgagagacaaaaggaaatgcttcga
aataatgaatccaaaatccttcatttacagcgagtgatagacagccaagcagagaaactg
aaggagctcgacaaggagatccggcccttccggcagaactgggaggaagcagacagcatg
aagagcagcgtggagtccctccagaaccgcgtgaccgagctggagagcgtggacaagagc
gcggggcaagtggctcggaacacaggcctgctggagtcccagctgagccggcatgaccag
atgctgagtgtgcacgacatccgcctggccgacatggacctccgcttccaggtcctggag
accgccagctacaacggcgtgctcatctggaagattcgtgactacaagcggcggaagcag
gaggctgtcatggggaagaccctgtccctttacagccagcctttctacactggctacttt
ggctataagatgtgtgccagggtctacctgaatggggacgggatgggaaaggggacgcac
ctgtcgctgttttttgtcatcatgcgtggagaatatgatgccctgcttccttggccattt
aagcagaaagtgacactcatgctgatggatcaggggtcctctcggcggcatttgggagat
gcgttcaagcccgaccccaacagcagcagcttcaagaagcccactggagagatgaatatt
gcctctggctgcccagtctttgtggcccagactgttctagaaaatgggacatatattaaa
gatgatacaatttttattaaagtcatagtggatacttcggatctgcccgatccctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515877
Entry
108515877         CDS       T04641                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04064  NF-kappa B signaling pathway
rbb04217  Necroptosis
rbb04621  NOD-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04668  TNF signaling pathway
rbb05163  Human cytomegalovirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108515877 (TRAF5)
   04668 TNF signaling pathway
    108515877 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108515877 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108515877 (TRAF5)
   04657 IL-17 signaling pathway
    108515877 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108515877 (TRAF5)
   05203 Viral carcinogenesis
    108515877 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108515877 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108515877 (TRAF5)
   05168 Herpes simplex virus 1 infection
    108515877 (TRAF5)
   05163 Human cytomegalovirus infection
    108515877 (TRAF5)
   05169 Epstein-Barr virus infection
    108515877 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108515877 (TRAF5)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    108515877 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-TRAF_2 zf-RING_UBOX zf-RING_2 zf-RING_6 zf-ACC ATG16 Sina BORCS8 Mt_ATP_synt DUF4941 Spc29 Acetyltransf_11 Syntaxin-6_N PHM7_cyt DUF4279 MCPsignal
Other DBs
NCBI-GeneID: 108515877
NCBI-ProteinID: XP_017708545
UniProt: A0A2K6KEA2
LinkDB
Position
Un
AA seq 557 aa
MAYSEEHRGMPCGFIRQNSGNSISLDFEPNIEYQFVERLEERYKCAFCRSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQAVQCSNENCREPVLRKDLKEHLSAYCQFREEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQE
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKSDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLNKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTGRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcttattcagaagagcatagaggtatgccctgtgggttcatccgtcagaattccggc
aactccatttccttggactttgagcccaatatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccgctcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagacaaggaggtcatcaaatctcaggaggtttttaaagacaattgctgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaacgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaagctgtgcagtgttct
aatgagaactgccgggaaccagtcctacggaaagacctgaaagagcatttgagtgcatac
tgtcagtttcgagaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtggatgaacacctggctgtatgtcccgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcaggaa
catgagcattcagccttacgggagcacatgcgtctggttttagaaaagaacgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaatct
gacctgaggcctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagctgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgaataaaaatgaagagcgatttaaactactggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagggaggca
gtggatgggcacacagtgtccatcttcagccagtccttctacaccggccgctgtggctac
cggctgtgtgctagagcatacctgaatggggatgggtctgggaaggggacacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgacactgatgcttctggaccagagtggcaaaaaaaacattatggagaccttcaag
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctacattaaagat
gacactctgttcttgaaagtggctgtggacttaactgacctggaggatctctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530161
Entry
108530161         CDS       T04641                                 

Definition
(RefSeq) TNF receptor-associated factor 4-like
  KO
K09848  TNF receptor-associated factor 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04657  IL-17 signaling pathway
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    108530161
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530161
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108530161
SSDB
Motif
Pfam: zf-TRAF Bunya_NS-S
Other DBs
NCBI-GeneID: 108530161
NCBI-ProteinID: XP_017728350
LinkDB
Position
Un
AA seq 446 aa
MRKCLLEGDAKGNPISLVIGTCNLSGAQDGYIRVTANMQREREHTSFSVGTVAQEDLPGH
LKDSCSSALVLCSFKDSSCKHRCPKWAMAQHVEESVKLHLAMMCALLSWQWQEQQDLQQE
LEELSVGSDGVLIWKTGSYGRVGTVAQEDLPGHLKDSCSSALVLCSFKDSSCKHRCPKWA
MAQHVEESVKLHLAMMCALLSWQWQEQQDLQQELEELSVGSDGVLIWKTGSYGRQLQEAK
AKPNLECFSPAFYTHKCGYKLQVSAFLNGKGSGEGTRLSLYVDLLPGAFDNLLEWSFARR
VTFCLLDQSDSGLAKPQQVTETFHPGPNWKHFQKPGTWGGSLDESSLGFGYPKFISHQDI
QKRKTMCSVGNRSWDHQGLKTSDRRDCLPSWFCRAAWGIPGECRIGEPIHDPSLWPSGKF
TCLQNDASTLPLRCGFSSYKATFRSA
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggaagtgcctcttagagggggatgctaagggcaaccccatttctctggttataggg
acctgcaacctcagtggggcccaagatgggtacattcgggtcaccgccaacatgcagaga
gagagagaacatacatctttttctgtgggcactgtggctcaggaggacctgccaggccat
ctgaaggacagctgtagcagcgccctggtgctatgctcattcaaagactccagctgcaag
cacaggtgccctaagtgggcaatggcacagcatgtggaggagagtgtgaagctacatcta
gccatgatgtgtgctctgttgagctggcaatggcaggagcagcaggaccttcagcaagag
ctggaggagctatcagtgggcagtgatggtgtgcttatctggaagactggcagttatggt
cgtgtgggcactgtggctcaggaggacctgccaggccatctgaaggacagctgtagcagc
gccctggtgctatgctcattcaaagactccagctgcaagcacaggtgccctaagtgggca
atggcacagcatgtggaggagagtgtgaagctacatctagccatgatgtgtgctctgttg
agctggcaatggcaggagcagcaggaccttcagcaagagctggaggagctatcagtgggc
agtgatggtgtgcttatctggaagactggcagttatggtcggcagctacaggaggccaag
gccaagcccaaccttgagtgcttcagcccagccttctacacacataagtgtggttacaag
ctgcaggtgtctgcattcctcaatggcaaaggcagtggtgagggcacacgcctctcactg
tacgttgacttgctgcctggtgcctttgacaatctccttgagtggtcctttgcccgccgt
gtcaccttctgcctgctggatcagagcgactctgggctggctaaaccacagcaggtcact
gagaccttccacccaggcccaaactggaagcatttccagaagccgggcacctgggggggc
tccctggatgagagttctttgggctttggttatcccaagttcatctcccaccaggacatc
caaaagcgaaaaactatgtgcagtgtggggaacaggtcttgggatcatcaagggctgaaa
acaagtgaccgcagggactgtctcccttcttggttctgcagggcggcctggggcatccct
ggggagtgccgcataggcgagcctatccatgatccttcactctggccttctggaaagttc
acctgccttcagaatgatgcctcaactcttcctctgcgatgtggtttctcttcctacaaa
gcaacattcaggagcgcctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535559
Entry
108535559         CDS       T04641                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04140  Autophagy - animal
rbb04144  Endocytosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108535559 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108535559 (TRAF6)
   04064 NF-kappa B signaling pathway
    108535559 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108535559 (TRAF6)
   04140 Autophagy - animal
    108535559 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108535559 (TRAF6)
   04621 NOD-like receptor signaling pathway
    108535559 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    108535559 (TRAF6)
   04657 IL-17 signaling pathway
    108535559 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108535559 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108535559 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535559 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108535559 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108535559 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108535559 (TRAF6)
   05135 Yersinia infection
    108535559 (TRAF6)
   05133 Pertussis
    108535559 (TRAF6)
   05152 Tuberculosis
    108535559 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108535559 (TRAF6)
   05161 Hepatitis B
    108535559 (TRAF6)
   05160 Hepatitis C
    108535559 (TRAF6)
   05171 Coronavirus disease - COVID-19
    108535559 (TRAF6)
   05162 Measles
    108535559 (TRAF6)
   05168 Herpes simplex virus 1 infection
    108535559 (TRAF6)
   05169 Epstein-Barr virus infection
    108535559 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108535559 (TRAF6)
   05140 Leishmaniasis
    108535559 (TRAF6)
   05142 Chagas disease
    108535559 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108535559 (TRAF6)
   04121 Ubiquitin system [BR:rbb04121]
    108535559 (TRAF6)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108535559 (TRAF6)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108535559 (TRAF6)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    108535559 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Spc29 zf-RING_11 U-box Tropomyosin_1 DUF16 PspA_IM30 EzrA AAA_13 ADIP FliJ UPF0242 DM DUF3450 TMF_DNA_bd CENP-F_leu_zip Filament Spc7 DUF1664 DivIC
Other DBs
NCBI-GeneID: 108535559
NCBI-ProteinID: XP_017737118
UniProt: A0A2K6MKD5
LinkDB
Position
Un
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPHEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgagtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagaattt
gacccacccctagaaagcaagtacgaatgccccatctgcttgatggcactacgagaagca
gtgcaaacaccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcgaaacgtgagattctttctctgatggtgaagtgtccacatgaaggttgtttg
cataagatggaactgaggcatcttgaggatcatcaagcacattgtgagtttgctcttgtg
gattgtccgcagtgccaacgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcagtggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagctccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagagaaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agccttatacccgactctgggtatgtctcagaggtccggaatttccaggaaactatccac
cagttagagggtcgccttgtaagacaagaccatcagatccgggagctgactgctaaaatg
gaaactcagagtacgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaattgaagcacagcagtgcaatggaatttacatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctgggttc
tacacaggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacgatgcaaggagagtatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtccgaagca
cctgtaaggcaaaaccatgaagagataatggatgccaaaccagacctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaactttcatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgcttcgacatgggtagccttcggagggagggttttcagccacgaagtactgattca
ggggtatag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537107
Entry
108537107         CDS       T04641                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04064  NF-kappa B signaling pathway
rbb04210  Apoptosis
rbb04668  TNF signaling pathway
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108537107 (TRAF1)
   04668 TNF signaling pathway
    108537107 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108537107 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108537107 (TRAF1)
   05202 Transcriptional misregulation in cancer
    108537107 (TRAF1)
   05203 Viral carcinogenesis
    108537107 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108537107 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd Not3
Other DBs
NCBI-GeneID: 108537107
NCBI-ProteinID: XP_017739740
UniProt: A0A2K6KI98
LinkDB
Position
Un
AA seq 416 aa
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCTGCLSENLRNGEDQICPKCRGE
DLQSVSPGSRLRTLERAHPEVAEAGVGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKTRMASGLESGPMALEQNLSDLQLQAAVEVARDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTGK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLNKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcatccagctcaggcagcagcccacgcccggcccctgatgagaatgagttccccttt
gggtgccctcccaccgtctgccaggacccaaaggagcctagggctctctgctgtacaggc
tgtctctctgagaacctgaggaacggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctgtaagcccaggaagccgtcttcgaactctggagagggctcatcctgag
gtggccgaggctggagttgggtgccccttcgcaggtgtcggctgctccttcaagggaagc
ccacagtccgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaagacccgaatggcctctggcctggagtctgggcccatggct
ctagagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgagggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaagggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctccatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagctgcag
cagaccctagcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcaccttcctgtggaagatcaccaatgttaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactggcaag
tatggctacaagttatgcctgcggctgtacctgaatggagatggcactggaaagaggacc
cacctgtcgcttttcatcgtgatcatgagaggggagtatgatgcgttgctgccgtggcct
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgat
gccttccggcctgacctaagctcggcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggctgcccactcttcttccccctcaacaaactgcagtcacccaagcatgcctac
gtgaaggacgacacgatgttcctcaagtgcatcgtggagaccagcacttag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539936
Entry
108539936         CDS       T04641                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04657  IL-17 signaling pathway
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    108539936 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539936 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108539936 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-Nse zf-TRAF_2 MATH Sina
Other DBs
NCBI-GeneID: 108539936
NCBI-ProteinID: XP_017744387
LinkDB
Position
Un
AA seq 470 aa
MPGFDXKVPEKPKRRLLCPLWRKPMREPVQVSTCGHRFATPGLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPGHLK
DSCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNFECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcctggtttcgacnntaaagttcctgagaagcccaagcgacggctgctgtgcccactg
tggcggaagcccatgcgcgagcctgtgcaggtttccacctgcggccaccgttttgcgaca
cctggcctgcaggagttcctcagtgaaggcgtcttcaagtgccctgaggaccagcttcct
ctggactatgccaagatctacccagacccggagctggaagtacaagtattgggcctgcct
atccgctgcatccacagtgaggagggctgccgctggagtgggccactacgccatctacag
ggccacctgaatacctgcagcttcaacgtcgttccctgccctaatcgctgccccatgaaa
ctgagccgccgtgatctacctgcgcacttgcagcacgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctatgagagccatgagggtatgtgc
ccccaggagagtgtctactgtgagaataaatgtggtgcccgcatgatgcggcggctgctg
gcccagcatgccacctctgagtgccccaagcgcactcagccctgcacctactgcaccaag
gagttcgtctttgacaccatccagagccaccagtaccagtgcccaaggctgcctgttccc
tgccccaaccagtgtggtgtgggcactgtggcccgggaggacctgccaggccatctgaag
gacagctgtagcactgccctggtgctctgcccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcacggcatgtggaggagagtgtgaagccacatctggccatg
atgtgtgccctggtaagccggcaacggcaggagctgcaggagcttcggcgagagctggag
gagctatcagtgggcagtgatggtgtgctcatctggaagattggcagctatggacggcgg
ctacaggaggccaaggccaagcccaactttgagtgcttcagccctgccttctacacacat
aagtatggttacaagctacaggtgtctgcattcctcaatggcaatggcagtggcgagggc
acacacctctcactgtacattcgtgtgctgcctggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtcaccttctccctgctggatcagagcgaccctgggctggctaaa
ccacagcacgtcactgagaccttccaccctgacccaaactggaagaatttccagaagccg
ggcacgtggcggggctccctggatgagagttctctgggctttggttatcccaagttcatc
tcccaccaggacattcgaaagcgaaactatgtgcgggatgatgcagtcttcatccgtgct
gctgttgaactgccccggaagatccttagctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542901
Entry
108542901         CDS       T04641                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04217  Necroptosis
rbb04380  Osteoclast differentiation
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04668  TNF signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05160  Hepatitis C
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108542901 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108542901 (TRAF2)
   04064 NF-kappa B signaling pathway
    108542901 (TRAF2)
   04668 TNF signaling pathway
    108542901 (TRAF2)
   04071 Sphingolipid signaling pathway
    108542901 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108542901 (TRAF2)
   04217 Necroptosis
    108542901 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108542901 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    108542901 (TRAF2)
   04657 IL-17 signaling pathway
    108542901 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108542901 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108542901 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108542901 (TRAF2)
   05203 Viral carcinogenesis
    108542901 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108542901 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108542901 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    108542901 (TRAF2)
   05016 Huntington disease
    108542901 (TRAF2)
   05017 Spinocerebellar ataxia
    108542901 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    108542901 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108542901 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108542901 (TRAF2)
   05135 Yersinia infection
    108542901 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108542901 (TRAF2)
   05160 Hepatitis C
    108542901 (TRAF2)
   05168 Herpes simplex virus 1 infection
    108542901 (TRAF2)
   05163 Human cytomegalovirus infection
    108542901 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108542901 (TRAF2)
   05169 Epstein-Barr virus infection
    108542901 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rbb03019]
    108542901 (TRAF2)
   04121 Ubiquitin system [BR:rbb04121]
    108542901 (TRAF2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108542901 (TRAF2)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     108542901 (TRAF2)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    108542901 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 MATH SlyX
Other DBs
NCBI-GeneID: 108542901
NCBI-ProteinID: XP_017748612
UniProt: A0A2K6M5P0
LinkDB
Position
Un
AA seq 501 aa
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACGNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPIDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADGKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCENLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccttggagttgctacagcctggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcggaaacgtc
ctgcgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggctttcccagataatgctgcccgcagggaggtg
gagagcctgccagccgtctgtcccattgatgggtgcacctggaaggggaccctgaaagaa
tatgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgtcctgcatgcaaa
ggcctggtccgcctgggtgaaaaggagcgccacctggagcacgagtgcccagagagaagc
ctgagctgccggcattgccgggcgccctgctgcggggcagacgggaaggcgcaccacgag
gtctgccccaagttccccttgacttgtgatggctgcggcaagaaaaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgagtcccttgtagattccacgcc
atcggctgcctcgagacggtggagggtgagaaacagcaagagcacgaggcacagtggctg
cgggagcacctggccatgctcctgagctcggtgctggaggcaaagcctctcttgggagac
cagagccatgcggggtcagagctcctacagaggtgcgagaacctggagaagaagacggcc
acttttgagaacattgtctgtgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtaacaag
gtgcagcagctggagaggagcattggcctcaaggatctggcgatggctgacctggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggccggccgcacacccgccatcttctccccagcc
ttctacaccagcaggtacgggtacaagatgtgtctgcgtatctacctgaacggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgctcgaccagaataatcgg
gagcacgtgattgatgccttcaggcccgacgtgacctcgtcctcttttcagaggccagtc
aatgacatgaacatcgcaagcggctgccccctcttctgccctgtctccaagatggaggcc
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

DBGET integrated database retrieval system