KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515043
Entry
108515043         CDS       T04641                                 

Gene name
ELOC, TCEB1
Definition
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108515043 (ELOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108515043 (ELOC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108515043 (ELOC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108515043 (ELOC)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108515043 (ELOC)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     108515043 (ELOC)
   ECS complex
     108515043 (ELOC)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108515043 (ELOC)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 108515043
NCBI-ProteinID: XP_017707113
UniProt: A0A2K6M1Y2
LinkDB
Position
Un
AA seq 112 aa
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acgataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcaaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccactgagattcccgaattcccaattgcacctgaaattgca
ctagaactgctgatggctgcgaacttcctagattgttaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534614
Entry
108534614         CDS       T04641                                 

Definition
(RefSeq) transcription elongation factor B polypeptide 1-like
  KO
K03872  elongin-C
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108534614
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108534614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534614
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108534614
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108534614
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     108534614
   ECS complex
     108534614
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108534614
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 108534614
NCBI-ProteinID: XP_017735560
LinkDB
Position
Un
AA seq 107 aa
MDEEKKTYGGCEGPDALYVKSISPEGHEFTVKKEHALTSGTIKAVLSGPGTFAENKTDEV
HFREIPSHVLSKVYACSLTNSSAEIPEFPVAPELALELLMAANFLDC
NT seq 324 nt   +upstreamnt  +downstreamnt
atggatgaagagaagaaaacctacggtggctgcgaaggccctgatgccttgtatgtcaaa
tcaatatcacctgagggccatgaatttactgtaaagaaagaacatgcattaacatcaggc
acgataaaagccgtgttgagtggcccaggtacatttgctgagaacaaaaccgatgaggtc
cattttagagagatcccttcacatgtgctatcaaaagtatatgcatgttcgctaactaac
agctccgccgagattcccgaattcccagttgcacctgaacttgcactagaactgctgatg
gctgcgaacttcctagattgttaa

DBGET integrated database retrieval system