KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515114Help
Entry
108515114         CDS       T04641                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00480  Glutathione metabolism
rbb00980  Metabolism of xenobiotics by cytochrome P450
rbb00982  Drug metabolism - cytochrome P450
rbb00983  Drug metabolism - other enzymes
rbb01524  Platinum drug resistance
rbb05200  Pathways in cancer
rbb05204  Chemical carcinogenesis
rbb05225  Hepatocellular carcinoma
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108515114 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108515114 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    108515114 (GSTO1)
   00983 Drug metabolism - other enzymes
    108515114 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    108515114 (GSTO1)
   05204 Chemical carcinogenesis
    108515114 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    108515114 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    108515114 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    108515114 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108515114 (GSTO1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108515114 (GSTO1)
Transporters [BR:rbb02000]
 Other Transporters
  Pores ion channels [TC:1]
   108515114 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5 Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 108515114
NCBI-ProteinID: XP_017707239
UniProt: A0A2K6LEZ5
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRVYSMRFCPFAERTLLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLLGSFIRSQNKEDHAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMTLHECVDHTPKLKLWMAAMKKDPTVSALLISEKDWQGFLELYVQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtctgccaggagcctggggaaaggaagcgcgcccccggggccggtcccg
gagggctcgatccgcgtctacagcatgaggttctgcccgtttgctgagaggacgcttctg
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctatgagtctcccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttgctaggaagctttattagaagccaaaataaagaagaccatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgacgttctttggtggcaattctatctctatgattgattatctcatctggccctgg
tttgaacggctggaagcaatgacgttacatgaatgtgtagaccacactccaaaacttaaa
ctgtggatggcagccatgaagaaagatcccacagtctcagccctgctcatcagtgagaag
gactggcaaggtttcctagagctttacgtacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system