KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515204Help
Entry
108515204         CDS       T04641                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04062  Chemokine signaling pathway
rbb04140  Autophagy - animal
rbb04270  Vascular smooth muscle contraction
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04722  Neurotrophin signaling pathway
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108515204 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108515204 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    108515204 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    108515204 (PRKCD)
   04062 Chemokine signaling pathway
    108515204 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108515204 (PRKCD)
   04915 Estrogen signaling pathway
    108515204 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108515204 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108515204 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108515204 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108515204 (PRKCD)
   04931 Insulin resistance
    108515204 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108515204 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108515204 (PRKCD)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108515204 (PRKCD)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108515204 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like C1_2 zf-RING-like Zf_RING Haspin_kinase zf-RING_9 PHD Pkinase_fungal DZR APH FYVE_2 DUF2318
Motif
Other DBs
NCBI-GeneID: 108515204
NCBI-ProteinID: XP_017707383
UniProt: A0A2K6LGX1
LinkDB All DBs
Position
Un
AA seq 676 aa AA seqDB search
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDSQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAVKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgccattcctgcgcatcgccttcaactcctacgagctgggctccctgcaggctgag
gacgaggcgaaccagcctttctgtgccgtgaagatgaaggaggcgctcagcacagagcgt
gggaaaacactggtgcagaagaaaccaaccatgtatcctgagtggaagtcgacattcgat
gcccacatctacgagggccgcgtcatccagatcgtgctaatgcgggcagccgaggagcca
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaacggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgttgatgtctgttcagtat
ttcctggaggacgtggattgcaaacagtctatgcgcagtgaggacgaggccaagttccca
acgatgaaccgccgaggagccatcaagcaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaaacaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgtactggcactgcggccaacagccgggacaccatattc
cagaaagaacgcttcaacatcgacatgccgcaccgcttcaaggttcacaactacatgagc
cccaccttctgtgaccactgcggcagcctgctctggggactggtgaagcagggattaaag
tgtgaagactgtggcatgaatgtgcaccataaatgccgggagaaggtggccaacctctgc
ggcatcaaccagaagctcttggccgaggccttgaaccaagtcacccagagagcctcccgg
agatcagactcggcctcctcagagcctgttgggatataccagggtttcgagaagaagacc
ggagtcgctggggaggactcgcaagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttt
gggaaggtgctgcttggagagctgaagggcagaggagagtactttgctgtcaaggccctc
aagaaggatgtggtcctgatcgacgacgacgtggaatgcaccatggttgagaagcgggtg
ctgacgctcgccgcagaaaatccctttctcacccacctcatctgcaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaacgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgcagctgagataatctgtgga
ctgcagtttctacacagcaagggcatcatttacagggacctcaaactggacaatgtgctg
ctggaccgggatggccatatcaagattgccgactttgggatgtgcaaagagaatatattc
ggggagaaccgggccagcaccttctgcggcactcctgactatatcgcccctgagatccta
cagggcctaaagtacacattctcggtggactggtggtctttcggggtccttctgtacgag
atgctcattggccagtcccccttccatggtgatgatgaggatgaactcttcgagtccatc
cgtgtggatacaccgcattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggaaccaaccaagaggctgggagtgaccggaaacatcaaaatccac
cccttcttcaagaccataaactggactctgctagaaaagcggaggttggagccacccttc
aggcccaaagtgaagtcccccagagactacagcaacttcgaccaggagttcctgaacgag
aaggcacgcctctcctacagcgacaagaacctcatcgactccatggaccagtctgcgttt
gccggcttctcctttgtgaaccccaaattcgagcacctcctggaagactga

DBGET integrated database retrieval system