KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515327Help
Entry
108515327         CDS       T04641                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00020  Citrate cycle (TCA cycle)
rbb00190  Oxidative phosphorylation
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb04714  Thermogenesis
rbb04932  Non-alcoholic fatty liver disease (NAFLD)
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05016  Huntington disease
Module
rbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rbb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108515327 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108515327 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    108515327 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    108515327 (SDHB)
   05012 Parkinson disease
    108515327 (SDHB)
   05016 Huntington disease
    108515327 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108515327 (SDHB)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108515327 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 108515327
NCBI-ProteinID: XP_017707615
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVALSLRGRLPATTLGAACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggggccggttaccggccacaacccttggcgcg
gcctgcctccaggcctcccgaggagcccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tacgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaaattgactcgactttgaccttcagaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccgcatatgtatgtgataaaggaccttgtt
cccgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system