KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515581
Entry
108515581         CDS       T04641                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04061  Viral protein interaction with cytokine and cytokine receptor
rbb04151  PI3K-Akt signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  Jak-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04672  Intestinal immune network for IgA production
rbb04940  Type I diabetes mellitus
rbb05135  Yersinia infection
rbb05142  Chagas disease (American trypanosomiasis)
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease (IBD)
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    108515581 (IL2)
   04151 PI3K-Akt signaling pathway
    108515581 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108515581 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108515581 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108515581 (IL2)
   04660 T cell receptor signaling pathway
    108515581 (IL2)
   04658 Th1 and Th2 cell differentiation
    108515581 (IL2)
   04659 Th17 cell differentiation
    108515581 (IL2)
   04672 Intestinal immune network for IgA production
    108515581 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108515581 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108515581 (IL2)
   05321 Inflammatory bowel disease (IBD)
    108515581 (IL2)
   05330 Allograft rejection
    108515581 (IL2)
   05332 Graft-versus-host disease
    108515581 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108515581 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108515581 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108515581 (IL2)
   05162 Measles
    108515581 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    108515581 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108515581 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108515581 (IL2)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108515581 (IL2)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Haparin
  Cytokines
   108515581 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 108515581
NCBI-ProteinID: XP_017708086
UniProt: A0A2K6MRS2
LinkDB
Position
Un
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagatactaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system