KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515698
Entry
108515698         CDS       T04641                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00220  Arginine biosynthesis
rbb00330  Arginine and proline metabolism
rbb01100  Metabolic pathways
rbb01230  Biosynthesis of amino acids
rbb05146  Amoebiasis
Module
rbb_M00029  Urea cycle
rbb_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108515698 (ARG1)
   00330 Arginine and proline metabolism
    108515698 (ARG1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108515698 (ARG1)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     108515698 (ARG1)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-GeneID: 108515698
NCBI-ProteinID: XP_017708284
UniProt: A0A2K6LXG4
LinkDB
Position
Un
AA seq 322 aa
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLEEQECDVKDYGDLSFADIPN
DSPFQIVKNPRSVGKANEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHASVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagtgctaagtccagaaccatagggattatcggagctcctttctcaaagggacagcca
cgaggaggggtggaggaaggccctacagtattgagaaaggctggtctgcttgagaaactt
gaagaacaagagtgtgatgtgaaggactatggggacctgtcctttgctgacattcctaat
gacagtccctttcaaattgtgaagaatccaaggtctgttggaaaagcgaatgagcagctg
gctggcaaggtggcagaagtcaagaagaatggaagaatcagcctggtgctgggtggagac
cacagtttggcaattggaagcatctctggccatgccagcgtccaccctgatctcggagtc
atctgggtggatgcccacactgatatcaacactccactgacaaccacaagtgggaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgacgccctgcatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactgggaattggcaaagtgatggaagaaacactcagttatctacta
ggaagaaagaaaaggccaattcatctgagttttgatgttgatggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgtcatacagagaaggtctctacatc
acggaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaacccgaacagtgaacacagcagtagcaataacc
ttggcttgttttggagttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533719
Entry
108533719         CDS       T04641                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00220  Arginine biosynthesis
rbb00330  Arginine and proline metabolism
rbb01100  Metabolic pathways
rbb01230  Biosynthesis of amino acids
rbb05146  Amoebiasis
Module
rbb_M00029  Urea cycle
rbb_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108533719 (ARG2)
   00330 Arginine and proline metabolism
    108533719 (ARG2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108533719 (ARG2)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     108533719 (ARG2)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-GeneID: 108533719
NCBI-ProteinID: XP_017734088
UniProt: A0A2K6MNX4
LinkDB
Position
Un
AA seq 354 aa
MSLRGSLSRLLQKRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVAFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYGQLPTPSSPDESENQARVRI
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagaagcgagtgcattccatcctgaag
aaatccgtccactctgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccgcgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctatagctgtgtcacactgggaggagaccac
agcctggcaattggtaccattagcggccatgcccgacactgcccagacctttgcgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagttgcatttctcctcagagaactacaggacaaggtaccacaactaccagga
ttttcctggatcaaaccttgtatctcttccccaagtattgtgtatattggtctaagagac
gtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gatattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgattggc
aagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactagct
ccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctagcagtggatgtgattgct
tcaagttttggtcagacaagagaaggagggcatattgtctatggccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system