KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515947Help
Entry
108515947         CDS       T04641                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb05034  Alcoholism
rbb05165  Human papillomavirus infection
rbb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    108515947 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    108515947 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    108515947 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108515947 (HDAC7)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108515947 (HDAC7)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108515947 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 108515947
NCBI-ProteinID: XP_017708615
LinkDB All DBs
Position
Un
AA seq 952 aa AA seqDB search
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHSNSPGIPYRTLEPL
ETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSL
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPXGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPLGPMQPRMEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELSHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWTGGLDPPMGDPEYLAAFRT
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctg
gccctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcag
cgctcggtggagcccatgaggctctccatggacacaccgatgcccgagttgcaggtggga
ccgcaggaacaagagttgcggcagcttctccacaaggacaagagcaagcgaagtgctgta
gccagcagcgtggtcaagcagaagctggcggaggtgattctgaaaaaacagcaggcggcc
ctagagagaacagtccattccaacagccccggcattccctacagaaccctggagcccctg
gagacggaaggagccgcccgctccatgctcagcagctttttgcctcctgttcccagcctg
cccagtgaccccccagagcacttccctctgcgcaagacagtctctgagcccaacctgaag
ctgcgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggaa
agtgcgccccccagcctccggcggcggcctgcagagaccctcggagactcctccccaagt
agtagcagcacgcctgcgtcagggtgcagctcccccaatgacagcgagcacggccccaat
cccatcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctctg
gccccgttcgccttgccgacagtgtccttgctgcccgcaatcacgctggggctgcccgcc
cctgccagggctgacagtgaccgcaggacccatccgactctgggccctncggggccgatc
ctggggagcccccacactcccctcttcctgccccatggcctggagcccgaggctgggggc
actttgccctctcgcctgcagcccattctcctcctggacccctcaggctctcatgccccg
ctgctgactgtgcccgggcttgggcccttgcccttccactttgcccagtccttaatgacc
accgagcggctctccgggtcaggtctccactggccactgagccggactcgctcagagccc
ctgccccccagtgccaccgctcccccaccgctgggccccatgcagccccgcatggagcag
ctcaaaactcacgtccaggtgatcaagaggtcagccaaaccgagtgagaagccccggctg
cggcagataccttcggctgaagacctggagacagatggtgggggaccgggccaggtggta
gacgatggcctggaacacagggagctgagccatgggcagcctgaggccagaggccctgct
cctctccagcagcacccccaggtgttgctctgggaacagcagcgactggctgggcggctc
ccccggggcagcaccggggacactgtgctgcttcctctggctcagggtgggcaccggcct
ctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagccccggaacctgcc
agccaggcccgagtcctctccagctcagagacccctgccaggaccctgcccttcaccaca
gggctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaacagcagg
cacccggagcatgccggccgcatccagagcatctggtcccggctgcaggagcggggactc
cggagccagtgtgagtgtctccgaggccggaaggcctccctggaggagctgcagtcggtc
cactctgagcggcacgtgcttctctatggcaccaacccgctcagccgcctcaaactggac
aacgggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggg
gttggggtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgg
gccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctgaagaatggt
ttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggcttctgc
ttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagcaaggctagcaag
atcctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttctaccaa
gaccccagtgtgctctacatctccctgcatcgccatgacgatggcaacttcttcccgggg
agtggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaatgtggcc
tggactggaggtctggatccccccatgggggatcctgagtacctggctgctttcaggaca
gtcgtgatgcccattgcccgagagttctctccagacctagtcctggtgtctgctggattt
gatgctgctgagggtcacccagccccactgggtggctaccatgtttctgccaaatgtttt
gggtacatgacgcagcaactgatgaacctggcaggaggtgcagtggtgctggccttggag
ggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctg
ggtaacaaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaatgcc
atccgctctctggaggccgtgatccgggtgcacagtaaatactggggctgcatgcagcgc
ctggcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaagaagtg
gaggcagtgaccgcactggcatccctctctgtgggcatcctggctgaagacaggccctcg
gagcagctggtggaggaagaagaacctatgaatctctaa

DBGET integrated database retrieval system