KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515952Help
Entry
108515952         CDS       T04641                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00010  Glycolysis / Gluconeogenesis
rbb00030  Pentose phosphate pathway
rbb00051  Fructose and mannose metabolism
rbb00052  Galactose metabolism
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb01230  Biosynthesis of amino acids
rbb03018  RNA degradation
rbb04152  AMPK signaling pathway
rbb05230  Central carbon metabolism in cancer
Module
rbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108515952 (PFKM)
   00030 Pentose phosphate pathway
    108515952 (PFKM)
   00051 Fructose and mannose metabolism
    108515952 (PFKM)
   00052 Galactose metabolism
    108515952 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    108515952 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    108515952 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    108515952 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108515952 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rbb03019]
    108515952 (PFKM)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     108515952 (PFKM)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108515952 (PFKM)
Messenger RNA biogenesis [BR:rbb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     108515952 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 108515952
NCBI-ProteinID: XP_017708623
UniProt: A0A2K6M2Q1
LinkDB All DBs
Position
Un
AA seq 851 aa AA seqDB search
MRKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPTKTDTLKSLDTLDDPDTV
RSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLGDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMGEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALLFQPVTELQDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEAAV
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagacgagtttcatctgaaatttttcatgtgtgtgattcaatctcgccagtta
gtcaggactcctcagagaacagctggggaagcttctacttctagcatgctcataccaaag
ccaccaacaaagacagacaccttgaagagtctagatactttggatgatccagacaccgtg
agaagcatacctgttttcaaaactgagtggatcatgacccatgaagagcaccatgcagcc
aaaaccctggggattggcaaagccatcgccgtcttaacctctggtggagatgcccaaggt
atgaatgctgctgtcagggctgtggttcgagttggtatcttcaccggtgcccgtgtcttc
tttgtccatgagggttatcaaggcctggtggatggtggagataacatcaaggaagccacc
tgggagagcgtttcgatgatgcttcagctgggaggcacggtgattggaagtgcccggtgc
aaggactttagggaacgagaaggacgactccgagctgcctacaacctggtgaagcgtggg
atcaccaatctctgtgtcattgggggtgatggcagcctcactggggctgacaccttccgt
tctgagtggagtgacttgttgggtgacctccagaaagcaggtaagatcacagatgaggag
gctacgaagtccagctacctgaacattgtgggcctggttgggtcaattgacaatgacttc
tgtggcaccgatatgaccattggcactgactctgccctgcaccggatcatggaaattgta
gatgccatcactaccactgcccagagccaccagaggacatttgtgttagaagtgatgggc
cgccactgtggatacctggcccttgtcacctctctgtcctgtggggccgactgggttttt
attcctgaatgtccgccagatgacgactgggaggagcacctttgtcgccgactcagcgag
acaaggaatcgtggttctcgtctcaacatcatcattgtggctgagggtgcaattgacaag
aatggaaaaccaatcacctcagaagacatcaagaatctggtggtaaagcgtctgggatat
gacacccgggttactgtcttggggcatgtgcagaggggtgggacgccatcggcctttgac
agaattctgggcagcagaatgggtgtggaagcagtgatggcacttttggaggggacccca
gataccccagcctgtgtagtaagcctctctggtaaccaggctgtgcgcctgcccctcatg
gaatgtgtccaggtgaccaaagatgtgaccaaggccatgggtgagaagaaatttgatgaa
gccctgaagctgagaggccggagcttcatgaacaactgggaggtatacaagcttctagct
catgtcagacccccggtatctaagagtggttcgcacacagtggctgtgatgaatgtgggg
gctccggctgcaggcatgaatgctgctgttcgctccactgtgaggattggacttatccag
ggcaaccgagtgctcgttgtccatgatggtttcgagggactggccaaggggcagatagag
gaagctggctggagctatgttgggggctggactggccaaggtggctctaaacttgggact
aaaaggactctacccaagaagagctttgaacagatcagtgccaatataactaagtttaac
attcagggccttgtcatcattgggggctttgaggcttacacaggtggcctggaactgatg
gagggcaggaagcagtttgatgagctctgcatcccatttgtggtcattcctgctacagtc
tccaacaacgtccctggctcagacttcagcgttggggctgacacagcactcaatactatc
tgcacgacctgtgaccgcatcaagcagtcagcagctggcaccaagcgtcgggtgtttatc
attgagactatgggtggctactgtggctacctggccaccatggctgggctggcagctggg
gccgatgctgcctacatttttgaggagcccttcaccattcgagatctgcaggcaaatgtt
gaacatctggtgcaaaagatgaaaacaactgtgaaaaggggcttggtgttaaggaatgaa
aagtgcaatgagaactataccactgacttcattttcaacctgtactctgaggaggggaag
ggcatcttcgacagcaggaagaatgtgcttggtcacatgcagcagggtgggagcccaacc
ccatttgataggaattttgccactaagatgggtgccaaggctatgaactggatgtctggg
aaaatcaaagagagttaccgtaatgggcggatcttcgccaatactccagactcgggctgt
gttctggggatgcgtaagagggctctgctcttccaaccagtgactgagctgcaggaccag
acagattttgagcatcgaatccccaaggaacagtggtggctgaaactgaggcccatcctc
aaaatcctagccaagtatgagattgacttggacacttcagaccatgcccacctggagcac
atcacccggaagcggtctggggaagctgctgtttaa

DBGET integrated database retrieval system