KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516177Help
Entry
108516177         CDS       T04641                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04146  Peroxisome
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108516177 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108516177 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    108516177 (SOD2)
   04213 Longevity regulating pathway - multiple species
    108516177 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    108516177 (SOD2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108516177 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 108516177
NCBI-ProteinID: XP_017709002
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLS
PNGGGEPKGELLEAIKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKERGQLQIAACPN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcaccacgcggcctacgtgaacaacctgaacgtcaccgag
gagaagtaccaggaggcgttggccaagggagatgttaccgcccagatagctcttcagcct
gcactgaagttcaatggtggtggtcatatcaatcatagcattttctggacaaacctcagc
cctaatggtggtggagaacccaaaggggagttgctggaagccatcaaacgtgactttggt
tcctttgaaaaatttaaggagaagctgacggctgcatctgttggtgtccaaggctcaggt
tggggttggcttggttttaataaggaacggggacagttacaaattgctgcttgtccaaat
caggatccactgcaaggaacaacaggccttattccactgctggggattgatgtgtgggag
cacgcttattaccttcagtataaaaatgtcaggcctgattacctaaaagctatttggaat
gtaatcaactgggagaatgtaactgaaagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system