KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516255Help
Entry
108516255         CDS       T04641                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04114  Oocyte meiosis
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb04270  Vascular smooth muscle contraction
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04918  Thyroid hormone synthesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04934  Cushing syndrome
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb05010  Alzheimer disease
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108516255 (ITPR3)
   04020 Calcium signaling pathway
    108516255 (ITPR3)
   04070 Phosphatidylinositol signaling system
    108516255 (ITPR3)
   04022 cGMP-PKG signaling pathway
    108516255 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108516255 (ITPR3)
   04210 Apoptosis
    108516255 (ITPR3)
   04218 Cellular senescence
    108516255 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108516255 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108516255 (ITPR3)
   04621 NOD-like receptor signaling pathway
    108516255 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    108516255 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    108516255 (ITPR3)
   04922 Glucagon signaling pathway
    108516255 (ITPR3)
   04929 GnRH secretion
    108516255 (ITPR3)
   04912 GnRH signaling pathway
    108516255 (ITPR3)
   04915 Estrogen signaling pathway
    108516255 (ITPR3)
   04921 Oxytocin signaling pathway
    108516255 (ITPR3)
   04918 Thyroid hormone synthesis
    108516255 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    108516255 (ITPR3)
   04924 Renin secretion
    108516255 (ITPR3)
   04925 Aldosterone synthesis and secretion
    108516255 (ITPR3)
   04927 Cortisol synthesis and secretion
    108516255 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108516255 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    108516255 (ITPR3)
   04971 Gastric acid secretion
    108516255 (ITPR3)
   04972 Pancreatic secretion
    108516255 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108516255 (ITPR3)
   04725 Cholinergic synapse
    108516255 (ITPR3)
   04728 Dopaminergic synapse
    108516255 (ITPR3)
   04726 Serotonergic synapse
    108516255 (ITPR3)
   04720 Long-term potentiation
    108516255 (ITPR3)
   04730 Long-term depression
    108516255 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    108516255 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    108516255 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    108516255 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108516255 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108516255 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108516255 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108516255 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108516255 (ITPR3)
   05163 Human cytomegalovirus infection
    108516255 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108516255 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108516255 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108516255 (ITPR3)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108516255 (ITPR3)
Ion channels [BR:rbb04040]
 Ligand-gated channels
  IP3 receptor
   108516255 (ITPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 108516255
NCBI-ProteinID: XP_017709133
UniProt: A0A2K6N0S7
LinkDB All DBs
Position
Un
AA seq 2671 aa AA seqDB search
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKATGMGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSDEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKTSLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPMGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
NEMGMSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLIIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPSNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDGELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagcct
gcggccggggacctggacaaccctcctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgctgatgtggtattgctgcagaagctgcagcacgcggcccagatggag
cagaagcaaaacgacacggagaacaagaaggtgcacggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacggtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgaccctggatgccacaggcaatgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaatggggacaacgtggtcgtgggg
gataaggtgatcctgaatcctgtcaacgctgggcaacctctgcatgccagcaattacgaa
ctcagcgataatgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagttccgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggttgttccatgcggagcaggagaagttcctgacctgtgatgagtacaagggcaag
ctgcaggtgttcctgagaaccacactgcgccagtcggccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggccacgggcaactacctggccgctgaggagaac
cccagttacaaaggtgatgcctcggatcccaaggcaacaggaatgggggcccagggccgt
gcaggccgcaggaatgctggggagaagatcaagtatcgcctggtggccgtgcctcatggc
aacgacattgcctctctctttgagctggaccccaccaccttacagaaaaccgactctttc
gtgccccggaactcatacgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccactaaggaagacaaggaggcctttgccatcgtgtcggtgcctgtgtccgagatccga
gacctggactttgccaatgatgccagctccatgctggccagcgccgtagagaaactcaat
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagtgatgtccccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacagatctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtacggctggaggag
ctgtcagaccagaagaacgccccctatcagcacatgttccgtctgtgttaccgcgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagtttgggatg
atgcagtcccagattggctatgacatcttggctgaggacaccatcaccgccctgctgcac
aacaatcgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacattgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatcaggaccgaacttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagacgaggaagtgtggctcacatggactgacaagaat
aacgagcaccatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaatgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgatgagatctcccagcagctgggtgtggacctgatt
ttcctgtgcatggcggatgagatgctgccctttgacctgcgtgcctctttctgccacctg
atgctgcacgtgcatgtggaccgcgacccccaggaactggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
cttaacaatgtggtcagcgaggctgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaacctcatctacttcggtttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggcggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtcagtcttcggtgcccccagc
ctgcctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatctcctatctgctgtctgtcttcaagaaggagttcgtggag
gtgtttcccatgcaggacagcggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgtatcggggagcaggcggaggccatgtttggagtggggaag
acaagcagcatgctggaggtggacgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgcttttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcagagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggtgaggaggtggag
gcaggcgcagccaaggacaagaaggagcggcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagattgtcaagggcatcctggaaaggctgaac
aagatgtgcggggtcggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggtgatgccaag
atgatggagatcctacgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctgcacaagcacctgcaccttttcctcacaccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctctgagatcagcgag
cccgtgttgcagcacttcgtgcacctgctggccacgcatgggcgccatgtgcagtacctg
gacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgatgatgtggtcgtgttctacaacgataagaca
tcgctggcccacttgctggacatgatgaaggccgcccgtgatggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggctgcctgcgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcaccgaggtgaaaatggcctatgtgaactttgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagaacttcaccctggacatggcgcgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccctggagaagtatgtgttgagcgtcgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtccactacacggctcctcgagtgtccgtggctacagcagcagcataagggc
tctgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatctcgctg
cccatggacctggacgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtgcaggctgagctgtccgtgctggtggacgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
ggaggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgtatcaaggtgctgcggaccctgcagcagatgctgctcaagaaaaccaagtatggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcctgaccccatgggcactggcctggacccagactggtcagca
atcgcagccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aaatcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccaccgtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgtgag
ccagtcgaccccaccaccaaaggccgcgtggcctccttttcgatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
aacgagatgggcatgtctgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgcgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaatgtgggcctcatcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacctgcattgtg
actcacgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaaactgctc
ctggctctgatggagagccggcatgacagtgaaaatgccgagcgcatcctcatcagcctg
cggccccaggagctggtggatgtcatcaagaaggcctacctgcaggaagaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccacaacatctacatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccagtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccagcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cctggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccactaccgag
caggacgagcagggcagcaaagtgagcgacttctttgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccctacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ctgctgttctggatcctcatctgcttctccattgcggccctgttcaccaagcgctacagc
attcgccccctcatcgtggcgctcatcctacgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagaccctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcatccttgaggtcgac
cgactgcccagcaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcggggctctcggtgcccgag
gtcctggaagaggatggggagctggacagcacagagcgggcctgtgacactctgctgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggtgtaggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcgcgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagcgagaagcagaagaaggaagagattctcaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacggtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtcctggtccgcgtgaagaacaag
accgactacacaggccccgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaac
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacagagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcatgagccgctga

DBGET integrated database retrieval system