KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516444
Entry
108516444         CDS       T04641                                 

Gene name
ITGA3
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04640  Hematopoietic cell lineage
rbb04810  Regulation of actin cytoskeleton
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108516444 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108516444 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108516444 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108516444 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108516444 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108516444 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108516444 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108516444 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108516444 (ITGA3)
   05414 Dilated cardiomyopathy
    108516444 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108516444 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108516444 (ITGA3)
   04515 Cell adhesion molecules [BR:rbb04515]
    108516444 (ITGA3)
   04090 CD molecules [BR:rbb04090]
    108516444 (ITGA3)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108516444 (ITGA3)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108516444 (ITGA3)
CD molecules [BR:rbb04090]
 Proteins
  108516444 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MLANA
Other DBs
NCBI-GeneID: 108516444
NCBI-ProteinID: XP_017709394
UniProt: A0A2K6KU44
LinkDB
Position
Un
AA seq 1064 aa
MGPGPSRAPRAPRLMLCALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQT
ERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIEDM
WLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTYHN
EMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDP
EDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQ
VGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHPSLLLH
GHSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLPRQPQQVIHGEKL
GLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVLDP
ALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGF
FSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQA
LENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRT
SEHTGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEV
IGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVMGE
SGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITIHGNG
SWPCRPPGDLVNPLNLTLTDPGDRLSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVL
TCATGRARCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSI
PTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFKRT
RYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDRYY
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctttgcgccttgatg
gtggcggccggcggctgtgtcgtctccgccttcaacctggatacccgattcctggtagtg
aaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcggcagaca
gagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtgcccgat
ggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaaggacgac
tgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgaggacatg
tggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgtgcccac
cgctatacacaggtgctatggtcggggtcagaagaccagcggcgcatggtgggcaagtgc
tatgtgcgaggcaatgacctagagctggaccccagtgatgactggcagacctaccacaac
gagatgtgcaacagcaacactgactacctggagacgggcatgtgccagctgggcaccagc
ggtggcttcacccagaacactgtgtactttggtgcccccggtgcctacaactggaaagga
aacagctacatgattcagcgtaaggagtgggacttatctgagtatagttacaaggaccca
gaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatcctgcac
cccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggtgcggtcttc
ttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggctcgcag
gtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatgggtggcag
gacctcctggtgggcgccccctactactttgagaggaaagaggaggtagggggtgctgtc
tatgtcttcatgaaccaggcaggaacctccttccctgctcacccctcactccttcttcat
ggccacagtggctccgccttcggcttatccgtggccagcattggtgacatcaaccaggat
ggatttcaggatattgctgtgggagctccatttgaaggcttgggcaaagtgtacatctat
cacagtagctctaaggggctccccagacagccccagcaggtaatccacggagagaagctg
ggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtggatgag
aacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctgcgggcc
cggcccgtcatcaacatcgtccacaagaccttggtggccaggcccgctgtgctggaccct
gcactttgcacggccacctcctgtgtgcaagtggagctgtgctttgcttacaaccagagt
gccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggccgacagg
gaccgccgcccgccccggctccgcttcgctggcagtgagtctgctgtcttccacggcttc
ttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaacctccgt
gacaaactccggcccatcatcatctccatgaactactctttacctttgcggatgcccgat
cgcccccggctggggctgaggtccctggacgcctacccgatccttaaccaggcacaggct
ctggagaaccacactgaggtccagttccagaaggagtgcggccccgacaacaagtgtgag
agcaacttgcagatgcgggcagccttcgtgtctgagcagcagcagaagctgagcaggctc
cagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacccggacc
tcggagcacaccggagaggacgcccacgaggcactgctcaccctggtggtgcctcccgcc
ctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatcttttgc
gagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgcctttgaggtc
atcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacgtcaagt
caccaggacaacctctggcccatgaccctcactctgctggtggactatacactccagacc
tcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatgggcgag
tctggcatgaaaactgtggaggatgttggaagccccctcaagtatgaattccaggtgggc
ccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggaatggccctat
gaagtcagcaatggcaagtggctgctgtatcccacggagatcaccatccatggcaatggg
tcctggccctgccgaccacctggagaccttgtcaaccctctcaacctcactcttactgac
cctggggacaggctgtcatccccacagcgcaggcggcgacagctggatccaggaggaggc
cagggtcccccacctgtcactctggctgctgccaaaaaagccaagtctgagactgtgctg
acctgtgccacagggcgtgcccgctgtgtgtggctggagtgccccatccctgatgccccc
attgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgaggattac
agagactttgaccgagtccgggtaaatggctgggctaccctgttcctccgaaccagtatc
cccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcggagctg
gtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggtgcgggg
ctgctgcttctggggctgatcattctcctgctgtggaagtgtgacttctttaagaggacc
cgctattaccagatcatgcccaagtaccacgcggtgcggatccgggaggaggagcgctac
ccacctccagggagcaccctacccaccaagaagcactgggtgaccagctggcagactcgg
gaccgatactactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522273
Entry
108522273         CDS       T04641                                 

Gene name
ITGA6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04514  Cell adhesion molecules
rbb04640  Hematopoietic cell lineage
rbb04810  Regulation of actin cytoskeleton
rbb05145  Toxoplasmosis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108522273 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108522273 (ITGA6)
   04514 Cell adhesion molecules
    108522273 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108522273 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108522273 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108522273 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522273 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108522273 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108522273 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108522273 (ITGA6)
   05414 Dilated cardiomyopathy
    108522273 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108522273 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108522273 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108522273 (ITGA6)
   04515 Cell adhesion molecules [BR:rbb04515]
    108522273 (ITGA6)
   04090 CD molecules [BR:rbb04090]
    108522273 (ITGA6)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108522273 (ITGA6)
  Exosomal proteins of breast milk
   108522273 (ITGA6)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108522273 (ITGA6)
CD molecules [BR:rbb04090]
 Proteins
  108522273 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 108522273
NCBI-ProteinID: XP_017717851
UniProt: A0A2K6MH12
LinkDB
Position
Un
AA seq 1091 aa
MAAAGQLCLLYLSAGLLPRLGSAFNLDAEEDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIYEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLRRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDTGKVFIYHGSANGINTK
PTQVLKGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKACFEYTAKPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQKEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgcggggcagctgtgcctgctctacctgtcggccgggctcctgccccggctc
ggctcagccttcaacttggacgctgaggaggacaacgtgatccggaaatatggggacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgcttgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaact
ggagggctgtacagctgtgacatcaccgcccgggggccatgcacacggatcgaatttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctatgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaggagagatatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacacgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
cctacacaggttctcaagggtaaatcaccttatttcggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatccaggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
gcctgttttgaatatactgctaaacccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatcggggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatacccaagaactaactctgaaaaggcagaaacagaaa
gtgtgcatggaggaaaccctctggctacaggataatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagaaccaagctctcgtaggcgagttaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatactgatgtgcac
ttcttaaaagagggatgtggagatgacaatgtatgtaacagcaaccttaaactagaatac
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttgacatattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgacactccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaaggagataaacttcctgaacctcaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagtgtgaacgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcatctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattcttgtgcgagccttcattgat
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggattttgatgcttgctctattagtgtttatactgtggaagtgtgga
ttcttcaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522903
Entry
108522903         CDS       T04641                                 

Gene name
ITGA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04611  Platelet activation
rbb04640  Hematopoietic cell lineage
rbb04810  Regulation of actin cytoskeleton
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108522903 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108522903 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108522903 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108522903 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108522903 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108522903 (ITGA2)
   04611 Platelet activation
    108522903 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522903 (ITGA2)
   05205 Proteoglycans in cancer
    108522903 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108522903 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108522903 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108522903 (ITGA2)
   05414 Dilated cardiomyopathy
    108522903 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108522903 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108522903 (ITGA2)
   04515 Cell adhesion molecules [BR:rbb04515]
    108522903 (ITGA2)
   04090 CD molecules [BR:rbb04090]
    108522903 (ITGA2)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108522903 (ITGA2)
  Exosomal proteins of bladder cancer cells
   108522903 (ITGA2)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108522903 (ITGA2)
CD molecules [BR:rbb04090]
 Proteins
  108522903 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 108522903
NCBI-ProteinID: XP_017718851
UniProt: A0A2K6MH67
LinkDB
Position
Un
AA seq 1180 aa
MRPGRTGPSPLLLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTVRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADIAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETTKV
FSIPFHKDCGEDGLCIADLVLDVQQIPAAQEQPFTVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSVSFKSENFRHTKELNCRTASCSNVTCWLKDLHMKGEYFVNVTTRIWN
GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPIGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgcggccaggacggacagggccctcgccactgctgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcatacaatgttggtctccctgaagcaaaaatattt
tctggtccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataagtgtcccgttgacctatccactgccacatgtgaaaaactaaatttgcagacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacaggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcagctcagccctgcccttccctcatagatgttgtagttgtatgtgat
gaatcaaacagtatttatccttgggatgcagtgaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttaaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacatttggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgacgaagtgctaccaaagtaatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaatgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gttggattcagcgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaggcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcacccactttgttgctggtgctcctcgggcaaat
tacaccggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccgaggtgaccagataggctcctatttcggtagcgtgctgtgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtaggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaaaagggcattttgagtcagcac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaacgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttataatggtcatcagggcactgtccgcacgaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatatagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaataagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaataatcaagtggccattgtatataacatc
acccttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccctgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactaccaaggtc
ttcagtattcctttccacaaagactgtggtgaggatggactttgcattgctgatctagtt
ctagatgtccaacaaataccagctgctcaagaacaaccctttactgtcagcaaccaaaac
aaaaggttaacattttcagtaacactgaaaaacaaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgtgatgtaggctac
cctgctttaaagagagaacaacaggtgacctttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaattcctctcctgtacgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttctgtatctttcaaaagtgaaaat
ttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgctgg
ttgaaagaccttcacatgaaaggagaatactttgttaatgtgactacaagaatttggaac
gggacttttgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatcaac
acctataaccctgagatatacgtgatcgaagataacactgttacgattcccctgatgata
atgaaacctgatgagaaagccgaagtaccaataggagttataataggaagtataatcgct
ggaatccttttgctgttagctctggttgcaattttatggaagcttggctttttcaaaaga
aaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagaactcaatagc
tga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532191
Entry
108532191         CDS       T04641                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin subunit alpha 2b
  KO
K06476  integrin alpha 2B
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04810  Regulation of actin cytoskeleton
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108532191 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    108532191 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108532191 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108532191 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108532191 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108532191 (ITGA2B)
   04611 Platelet activation
    108532191 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    108532191 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532191 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108532191 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532191 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    108532191 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108532191 (ITGA2B)
   05414 Dilated cardiomyopathy
    108532191 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108532191 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108532191 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108532191 (ITGA2B)
   04515 Cell adhesion molecules [BR:rbb04515]
    108532191 (ITGA2B)
   04090 CD molecules [BR:rbb04090]
    108532191 (ITGA2B)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108532191 (ITGA2B)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108532191 (ITGA2B)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108532191 (ITGA2B)
CD molecules [BR:rbb04090]
 Proteins
  108532191 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 108532191
NCBI-ProteinID: XP_017731557
LinkDB
Position
Un
AA seq 1039 aa
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEESEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENNFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LGSYYQRLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHTLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLESPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLKLQMDTANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNTQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQH
SDLLYIVDIQPQGGLQCFPQPPVNPRKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAW
FNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaatctggacccagtgcatctcacc
ttctatgcaggccccaatggcagccactttgggttttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccacggaccctgggtcccagccaggaggag
acgggcggcgtgttcctgtgcccctggagagccgagggcggccagtgcccctcgctactc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactaggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagaccgaggagtctgagaagacgcccgtaggcagc
tgctttttggctcagccagagagcggccgccgcgccgagtactccccctgtcgcgggaac
accctgagccgcatttacgtggaaaataattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggcgggggagctggtgcttggggctcctggaggctat
tatttcttaggtctactggcccaggctccaattgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctccttcgactccagcaacccagag
tatttcgacggctactgggggtactcggtggctgtgggcgagttcgacggggatctcaac
actacagagtatgtcgtcggtgcccccacttggagctggacgctgggagcggtggaaatt
ttgggctcctactaccagaggctgcaccggctacacggagagcagatggcttcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgacctgctggtgggc
gctccactgtatatggaaagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacacgctgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccaggat
ggctacaatgacattgcagtggctgccccctacgggggtcccagtggccggggccaagtg
ctggtgttcctgggtcagagtgaggggctgagttcacgtccctcccaggtcctggaaagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgattgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggtacaagattcactgaatcctgct
gtgaagagctgtgtcctaccccagaccaagacacccgtgagctgcttcaaaatccagatg
tgtgttggagccactgggcacaacattcctcagaagctgtccctaaatgccgagctgcag
ttggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggcggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggccgaattccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctgccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgcggggaagatgacgtgtgtgtg
ccccagcttcagctcactgccagcgtgacaggctccccgctcctagttggggcagataat
gtcctgaagctgcagatggacacagccaacgagggcgagggggcctatgaagcagagctg
gccgtgcatctgccccagggggcccactacatgcgggccctaagcaacgtcgagggcttt
gagagactcatctgtaaccagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaatcccatgaagaagaacacccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatccggagcaagaacagccag
aatccaaacagcaagattgtgctgctggatgtgccagtccgggcagaggcccaagtggag
ctgcgagggaactcctttccagcctccctggtggtggctgcagaagaaggtgacagggag
cagaacagcttggacagccggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggccttcacctcagcatccacctcccggggcagtcccagcac
tccgacctgctctatatcgtggatatacagccccaggggggccttcagtgcttcccacag
cctcctgtcaacccccgcaaggtggactgggggctgcccacccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacagatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcag
tgtgacctgcaggagatggcgcgcgggcagcgggccatggtcacggtgctggctttcctg
tggctgcccagtctccaccagaggccactggatcagtttgtgctgcagtcacaggcgtgg
ttcaacgtgtcctccctcccctacgctgtgcccccgctcagcctgccacgaggggaagct
caggtgcggacacagctgcttcgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggcggcctgctgctgctcaccatcctggtcctggccatgtggaag
gtgggcttcttcaagcggaaccggccacccctggaagaagatgatgaagagggggagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535417
Entry
108535417         CDS       T04641                                 

Gene name
ITGAV
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04514  Cell adhesion molecules
rbb04810  Regulation of actin cytoskeleton
rbb04919  Thyroid hormone signaling pathway
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108535417 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108535417 (ITGAV)
   04514 Cell adhesion molecules
    108535417 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108535417 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108535417 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108535417 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108535417 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535417 (ITGAV)
   05205 Proteoglycans in cancer
    108535417 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108535417 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108535417 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    108535417 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108535417 (ITGAV)
   05414 Dilated cardiomyopathy
    108535417 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108535417 (ITGAV)
   05165 Human papillomavirus infection
    108535417 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108535417 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108535417 (ITGAV)
   04515 Cell adhesion molecules [BR:rbb04515]
    108535417 (ITGAV)
   04090 CD molecules [BR:rbb04090]
    108535417 (ITGAV)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108535417 (ITGAV)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108535417 (ITGAV)
  Exosomal proteins of epithelial cells
   108535417 (ITGAV)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108535417 (ITGAV)
CD molecules [BR:rbb04090]
 Proteins
  108535417 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 108535417
NCBI-ProteinID: XP_017736919
UniProt: A0A2K6L2L7
LinkDB
Position
Un
AA seq 1048 aa
MASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTELKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSIYNFTGD
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFFYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVFVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctggacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacacgacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggacgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaagataaaattttggcctgtgcccca
ttgtaccattggaggactgagttgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgcagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagttatttgggttactctgtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccatatacaattttactggcgat
cagatggctgcatatttcgggttttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccag
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacaacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaatcgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgctttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccagaaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttttctacagcaggtccccaagtcactccaagaacatgactatttcaagaggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattaccatttttatggaatattggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttttgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcattgtttccattccactgcag
gctgatttcatcggggttgtccgaaacagtgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctcaagtcct
gatcatatctttcttccgattccaaactgggagcacaaggagaaccccgagactgaagaa
gatgttgggccggttgttcagcacatctatgagctgagaaacaatggtccgagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataacaataacactttgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatttcatctttgcaaacaactgaaaagaatgacacagttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagtcgctcagtgcttgaagattgtctgccaagttggaagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacctttatgaat
aaagaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataaaaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcacccatgcctgtgcctgtgtgggtgatcattttagca
gttcttgcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaggaacaagaaagggaacaacttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

DBGET integrated database retrieval system