KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516558
Entry
108516558         CDS       T04641                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04068  FoxO signaling pathway
rbb04144  Endocytosis
rbb04218  Cellular senescence
rbb04350  TGF-beta signaling pathway
rbb04380  Osteoclast differentiation
rbb04390  Hippo signaling pathway
rbb04520  Adherens junction
rbb04659  Th17 cell differentiation
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05142  Chagas disease
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108516558 (TGFBR2)
   04350 TGF-beta signaling pathway
    108516558 (TGFBR2)
   04390 Hippo signaling pathway
    108516558 (TGFBR2)
   04068 FoxO signaling pathway
    108516558 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108516558 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108516558 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    108516558 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108516558 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108516558 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108516558 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108516558 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108516558 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    108516558 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108516558 (TGFBR2)
   05212 Pancreatic cancer
    108516558 (TGFBR2)
   05225 Hepatocellular carcinoma
    108516558 (TGFBR2)
   05226 Gastric cancer
    108516558 (TGFBR2)
   05220 Chronic myeloid leukemia
    108516558 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108516558 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108516558 (TGFBR2)
   05161 Hepatitis B
    108516558 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108516558 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108516558 (TGFBR2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108516558 (TGFBR2)
Protein kinases [BR:rbb01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108516558 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 108516558
NCBI-ProteinID: XP_017709600
UniProt: A0A2K6LI48
LinkDB
Position
Un
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVKFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSSWEAGKARKLMDFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLMRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcttgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaacaatgacatgatggtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgaaattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgaaaagcca
caggaagtctgtgtggctgtatggagaaagaacgacgagaacataacactagagacagtg
tgccatgatcccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagaccttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatacaacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgtgttaatcggcagcagaagctgagttcatcc
tgggaagctggcaaggcacggaagctcatggacttcagcgagcactgtgccatcatcctg
gaagacgaccgctctgacatcagctccacatgcgccaacaacatcaaccacaacacagag
ctgctgcccattgaactggacaccctggtgggaaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacggagaaggacatcttctcagacatcaacctgaag
catgagaacatactccagttcctgacagctgaggagcggaagacggagttggggaaacag
tactggctgatcactgccttccatgccaagggcaacctacaggagtacctgatgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcattgctcac
ctccacagtgatcacactccgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctgacctgctgcctctgtgactttgggcta
tccctgcgtctggaccctaccctgtccgtggatgacctggctaacagcggccaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgtagag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatcgcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgaggacgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcacctggacaggctctcggggaggagctgctcagaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system