KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517465Help
Entry
108517465         CDS       T04641                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb05034  Alcoholism
rbb05165  Human papillomavirus infection
rbb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    108517465 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    108517465 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    108517465 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rbb01009]
    108517465 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:rbb03019]
    108517465 (HDAC6)
   04131 Membrane trafficking [BR:rbb04131]
    108517465 (HDAC6)
   03036 Chromosome and associated proteins [BR:rbb03036]
    108517465 (HDAC6)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108517465 (HDAC6)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108517465 (HDAC6)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     108517465 (HDAC6)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    108517465 (HDAC6)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108517465 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 108517465
NCBI-ProteinID: XP_017710908
LinkDB All DBs
Position
Un
AA seq 1257 aa AA seqDB search
MEKKGQGARVPTGRQKLGRASQGRSLRKGLRPNRGRGQASSTMTSTGQDSTTTRQRRSRQ
NPQSPTQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIAGLQGMDLNL
EAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEK
EELMLVHSLEYIDLMETTQYMNEGELHVLADTYDSVYLHPNSYSCACLASGSVLRLVDAV
LGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQ
GTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDAD
YIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKL
ILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVL
VRSTETVEGDNMEEDNVEENEEEGPWEPPVLPILTWPVLQSRTGLVYDQSMMNHCNLWDS
HHPEVPQRILRIMCRLEELGLAGRCHTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRE
LHRESSNFDSIYICPSTFACAQLATGAACCLVEAVLSGEVLNGAAVVRPPGHHAEQDAAC
GFCFFNSVAVAARHAQAISGRALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGT
FFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVS
AGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSL
LGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQP
AKPRLAERMTTREKKVLEAGMGTITSASFGEESTPGQTKSETAVVALTQDQSSEAATGGA
TLAQTISEAAVGGAMLGQTTSEEAVGGATPDQTTSEKTVGGATLDQTTSEDAVGGATLGQ
TTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQ
GTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGL
TDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTMQENWVCLSCYQVYCGRYIN
GHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaggccagggcgctcgcgtccccacgggtcgccagaaacttggcagagcg
agccaagggcggagtttgagaaaggggctgcgtccaaaccgcggcaggggtcaagcctcc
tcaactatgacctcaaccggccaggattctaccacaaccaggcagcgaagaagtaggcag
aacccccaatctcccactcaggactccagtgtcacttcgaagcgaaacattaaaaaggga
gccgttccccgctccatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaag
ctcggccaagcaatggaagaagacctaatcgcgggactgcaagggatggatctgaacctt
gaggctgaagcactggctgggactggcttggtgttggatgagcagctaaatgaattccat
tgcctctgggatgacagcttcccagaaggccctgagcggctccatgccatcaaagagcaa
ctgatccaggagggcctcctagatcgctgtgtgtcctttcaggcccggtttgctgaaaag
gaagagctgatgttggttcacagcctagaatatattgatctgatggaaacaactcagtac
atgaatgagggagaactccacgtcctagcagacacttacgactcagtttatctgcatccg
aactcatactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtc
ctgggggctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccag
cacagtcttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgct
caacagaaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaa
ggaacacagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctat
gagcagggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggc
caaggccaaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgac
tacattgctgctttcttgcacgtcctgctgccagtcgccctcgagttccagcctcagctg
gtcctggtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgcc
actccggcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctg
atcctgtctctggagggtggctacaacctccgcgccctggctgaaggtgtcagtgcttcg
ctccacacccttctgggagacccttgccccatgctggagtcacctggtgccccctgccgg
agtgcccaggcttcagtctcctgtgctctggaagcccttgagcccttctgggaggttctt
gtgagatcaactgagaccgtggagggggacaacatggaggaggacaatgtagaggagaat
gaggaggaaggaccctgggagccccctgtgctcccaatcctgacgtggccagtgctacag
tctcgcacagggctggtctatgaccaaagtatgatgaatcactgcaacttgtgggacagc
caccaccctgaggtaccacagcgcatcttgcggatcatgtgccgtctggaggagctgggc
cttgctgggcgctgccacaccctgacaccgcgccccgccacagaggctgagctgctcacc
tgccacagtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggag
ctgcaccgtgagagttccaactttgactccatctacatctgccccagtaccttcgcctgt
gcacagcttgccactggcgctgcctgctgcctggtggaggctgtgctctcgggagaggtt
ctgaatggtgctgctgtggtgcgtcccccaggacaccacgcggagcaggatgcagcttgt
ggtttttgctttttcaactccgtggctgtggctgctcgccatgcccaggctatcagtggg
cgtgccctgcggatcctgattgtggattgggatgtccaccatggtaatggaactcagcac
atgtttgaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcacc
ttcttccccatgggggatgagggtgccagcagtcagatcggccgggctgccggcacaggc
ttcaccgtcaacgtggcatggaacgggccccgcatgggtgacgctgactacctagctgcc
tggcatcgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctca
gctggctttgatgctgcacggggggacccgctggggggctgccaggtgtcacctgagggt
tatgcccacctcacccacctgctgatgggccttgccagtggccgcattatccttatccta
gagggtggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctc
cttggagacccgccacccctgctgaccctgccacggccccctctatcaggggccctggcc
tcaatcactgagactatccaagtccatcgcagatactggcgcagcttacgggtcatgaag
gtagaagacagagagggaccctccagttctaagttggtcaccaagaaggcaccccaacca
gccaaacctaggttagctgagcggatgaccacacgagaaaagaaggttctggaagcaggc
atgggaacgatcacctcggcatcatttggggaagagtccactccaggccagactaagtca
gagacagctgtggtggccctcactcaggaccagtcctcagaggcagccacagggggagcc
acactggcccagaccatctctgaggcagccgttgggggagccatgctgggccagaccacc
tcagaggaggctgtcgggggagccactccggaccagaccacctcagagaagactgtggga
ggagccactctggaccagaccacctcagaggatgctgttgggggagccacgctgggccag
actacctcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagcc
atggagggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctg
atccaaactcctctagcctcgagcacagaccaccagacccccccaacctcacctgtgcag
ggaactacaccccagatatctcccagtacactgattgggagtctcaggaccttggagcta
ggcagcgaatctcagggggcctcagaatctcaggccccaggagaggagaacctactagga
gaggcagctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctc
actgatcaggccatattttatgctgtgacaccactgccctggtgtccccatttggtggca
gtatgccccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaaca
atgcaagagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaat
ggccacatgctccaacaccatggaaattctggacacccgttggtcctcagctacatcgac
ctgtcagcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtg
aagaacatcgcccaccagaacaagtttggggaggatatgccccacccacactaa

DBGET integrated database retrieval system