KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517508
Entry
108517508         CDS       T04641                                 

Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04024  cAMP signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04310  Wnt signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04530  Tight junction
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05231  Choline metabolism in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108517508
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108517508
   04012 ErbB signaling pathway
    108517508
   04014 Ras signaling pathway
    108517508
   04310 Wnt signaling pathway
    108517508
   04668 TNF signaling pathway
    108517508
   04068 FoxO signaling pathway
    108517508
   04071 Sphingolipid signaling pathway
    108517508
   04024 cAMP signaling pathway
    108517508
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108517508
   04137 Mitophagy - animal
    108517508
  09143 Cell growth and death
   04210 Apoptosis
    108517508
   04215 Apoptosis - multiple species
    108517508
   04217 Necroptosis
    108517508
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108517508
   04530 Tight junction
    108517508
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108517508
   04621 NOD-like receptor signaling pathway
    108517508
   04622 RIG-I-like receptor signaling pathway
    108517508
   04625 C-type lectin receptor signaling pathway
    108517508
   04660 T cell receptor signaling pathway
    108517508
   04658 Th1 and Th2 cell differentiation
    108517508
   04659 Th17 cell differentiation
    108517508
   04657 IL-17 signaling pathway
    108517508
   04664 Fc epsilon RI signaling pathway
    108517508
  09152 Endocrine system
   04910 Insulin signaling pathway
    108517508
   04920 Adipocytokine signaling pathway
    108517508
   04912 GnRH signaling pathway
    108517508
   04914 Progesterone-mediated oocyte maturation
    108517508
   04917 Prolactin signaling pathway
    108517508
   04926 Relaxin signaling pathway
    108517508
   04935 Growth hormone synthesis, secretion and action
    108517508
  09156 Nervous system
   04728 Dopaminergic synapse
    108517508
   04723 Retrograde endocannabinoid signaling
    108517508
   04722 Neurotrophin signaling pathway
    108517508
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108517508
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108517508
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108517508
   05231 Choline metabolism in cancer
    108517508
  09162 Cancer: specific types
   05210 Colorectal cancer
    108517508
   05212 Pancreatic cancer
    108517508
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108517508
   05012 Parkinson disease
    108517508
   05016 Huntington disease
    108517508
   05017 Spinocerebellar ataxia
    108517508
   05020 Prion disease
    108517508
   05022 Pathways of neurodegeneration - multiple diseases
    108517508
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108517508
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108517508
   04932 Non-alcoholic fatty liver disease
    108517508
   04931 Insulin resistance
    108517508
   04933 AGE-RAGE signaling pathway in diabetic complications
    108517508
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108517508
   05135 Yersinia infection
    108517508
   05133 Pertussis
    108517508
   05152 Tuberculosis
    108517508
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108517508
   05170 Human immunodeficiency virus 1 infection
    108517508
   05161 Hepatitis B
    108517508
   05171 Coronavirus disease - COVID-19
    108517508
   05162 Measles
    108517508
   05167 Kaposi sarcoma-associated herpesvirus infection
    108517508
   05169 Epstein-Barr virus infection
    108517508
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108517508
   05142 Chagas disease
    108517508
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108517508
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108517508
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108517508
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108517508
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 108517508
NCBI-ProteinID: XP_017710971
LinkDB
Position
Un
AA seq 317 aa
MELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI
LDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQG
TDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERD
KIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREH
AIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLAS
DTDSSLDASTGPLEGCR
NT seq 954 nt   +upstreamnt  +downstreamnt
atggagttaatggatgctaacttatgtcaagttattcacatggagctggatcatgaaaga
atgtcctaccttctttaccagatgctttgtggtattaaacatctgcattcagctggtata
attcatagagatttgaagcctagcaacatcgttgtgaaatcagactgcaccctgaagatc
cttgactttggcctggcccggacggcctgcaccaacttcatgatgaccccttacgtggta
acccggtactaccgggcgcccgaagtcatcctgggtatgggctacaaagagaacgttgat
atctggtcagtgggttgcatcatgggagagctggtgaaaggttgtgtgatattccaaggc
actgaccatattgatcagtggaataaagtcattgagcagcttggaacaccatcagcagag
ttcatgaagaaactccagccaactgtgaggaattatgtagaaaacagaccaaagtatcct
ggaatcaaattcgaagaactctttccagattggatattcccatcagagtctgagcgagac
aaaataaaaacaagtcaagccagagatctgttatcgaaaatgctagtgattgatcctgac
aagcggatctctgtagatgaagctctgcgtcacccatacatcactgtctggtacgacccc
gccgaagcagaggcaccaccacctcagatttatgatgcccagttggaagaaagagaacat
gcaattgaagaatggaaagagctaatttacaaagaagtcatggattgggaagaaagaagc
aagaatggtgttgtaaaagatcagccttcagatgcagcagtaagtagcaacgccactcct
tctcagtcttcatctatcaatgacatttcatccatgtccactgagcagacactggcctca
gacacagacagcagtcttgatgcctcgacgggaccccttgaaggttgtcgatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521141
Entry
108521141         CDS       T04641                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04024  cAMP signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04310  Wnt signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04530  Tight junction
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05231  Choline metabolism in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108521141 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108521141 (MAPK10)
   04012 ErbB signaling pathway
    108521141 (MAPK10)
   04014 Ras signaling pathway
    108521141 (MAPK10)
   04310 Wnt signaling pathway
    108521141 (MAPK10)
   04668 TNF signaling pathway
    108521141 (MAPK10)
   04068 FoxO signaling pathway
    108521141 (MAPK10)
   04071 Sphingolipid signaling pathway
    108521141 (MAPK10)
   04024 cAMP signaling pathway
    108521141 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108521141 (MAPK10)
   04137 Mitophagy - animal
    108521141 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    108521141 (MAPK10)
   04215 Apoptosis - multiple species
    108521141 (MAPK10)
   04217 Necroptosis
    108521141 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108521141 (MAPK10)
   04530 Tight junction
    108521141 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108521141 (MAPK10)
   04621 NOD-like receptor signaling pathway
    108521141 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    108521141 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    108521141 (MAPK10)
   04660 T cell receptor signaling pathway
    108521141 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    108521141 (MAPK10)
   04659 Th17 cell differentiation
    108521141 (MAPK10)
   04657 IL-17 signaling pathway
    108521141 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    108521141 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108521141 (MAPK10)
   04920 Adipocytokine signaling pathway
    108521141 (MAPK10)
   04912 GnRH signaling pathway
    108521141 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    108521141 (MAPK10)
   04917 Prolactin signaling pathway
    108521141 (MAPK10)
   04926 Relaxin signaling pathway
    108521141 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    108521141 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    108521141 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    108521141 (MAPK10)
   04722 Neurotrophin signaling pathway
    108521141 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108521141 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108521141 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108521141 (MAPK10)
   05231 Choline metabolism in cancer
    108521141 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108521141 (MAPK10)
   05212 Pancreatic cancer
    108521141 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108521141 (MAPK10)
   05012 Parkinson disease
    108521141 (MAPK10)
   05016 Huntington disease
    108521141 (MAPK10)
   05017 Spinocerebellar ataxia
    108521141 (MAPK10)
   05020 Prion disease
    108521141 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    108521141 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108521141 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108521141 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    108521141 (MAPK10)
   04931 Insulin resistance
    108521141 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108521141 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108521141 (MAPK10)
   05135 Yersinia infection
    108521141 (MAPK10)
   05133 Pertussis
    108521141 (MAPK10)
   05152 Tuberculosis
    108521141 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108521141 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    108521141 (MAPK10)
   05161 Hepatitis B
    108521141 (MAPK10)
   05171 Coronavirus disease - COVID-19
    108521141 (MAPK10)
   05162 Measles
    108521141 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108521141 (MAPK10)
   05169 Epstein-Barr virus infection
    108521141 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108521141 (MAPK10)
   05142 Chagas disease
    108521141 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108521141 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108521141 (MAPK10)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108521141 (MAPK10)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108521141 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 108521141
NCBI-ProteinID: XP_017716279
UniProt: A0A2K6JW84
LinkDB
Position
Un
AA seq 426 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcaggggatagtt
tgtgccgcgtatgatgctgtccttgatagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacccatgccaagagagcataccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggag
ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcag
atggaattagaccacgagcgaatgtcttacctgctgtaccaaatgctgtgtggcattaag
cacctccactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccatatgtggtgacacgttattacagagcccccgaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcgggactcaccttccccaagctcttcccagattccctcttc
ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggatgacgccttacagcatccctac
atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaag
cagttggatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagta
atgaactcagaagagaagactaaaaatggcgtagtaaaaggacaaccttctccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgttaatgacatctcctcc
atgtccaccgaccagaccctggcatctgacactgacagcagcctggaagcttcggcagga
cccctgggttgttgcaggtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537794
Entry
108537794         CDS       T04641                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04024  cAMP signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04310  Wnt signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04530  Tight junction
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05231  Choline metabolism in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108537794 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108537794 (MAPK8)
   04012 ErbB signaling pathway
    108537794 (MAPK8)
   04014 Ras signaling pathway
    108537794 (MAPK8)
   04310 Wnt signaling pathway
    108537794 (MAPK8)
   04668 TNF signaling pathway
    108537794 (MAPK8)
   04068 FoxO signaling pathway
    108537794 (MAPK8)
   04071 Sphingolipid signaling pathway
    108537794 (MAPK8)
   04024 cAMP signaling pathway
    108537794 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108537794 (MAPK8)
   04137 Mitophagy - animal
    108537794 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    108537794 (MAPK8)
   04215 Apoptosis - multiple species
    108537794 (MAPK8)
   04217 Necroptosis
    108537794 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108537794 (MAPK8)
   04530 Tight junction
    108537794 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108537794 (MAPK8)
   04621 NOD-like receptor signaling pathway
    108537794 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    108537794 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    108537794 (MAPK8)
   04660 T cell receptor signaling pathway
    108537794 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    108537794 (MAPK8)
   04659 Th17 cell differentiation
    108537794 (MAPK8)
   04657 IL-17 signaling pathway
    108537794 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    108537794 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108537794 (MAPK8)
   04920 Adipocytokine signaling pathway
    108537794 (MAPK8)
   04912 GnRH signaling pathway
    108537794 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    108537794 (MAPK8)
   04917 Prolactin signaling pathway
    108537794 (MAPK8)
   04926 Relaxin signaling pathway
    108537794 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    108537794 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    108537794 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    108537794 (MAPK8)
   04722 Neurotrophin signaling pathway
    108537794 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108537794 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108537794 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108537794 (MAPK8)
   05231 Choline metabolism in cancer
    108537794 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108537794 (MAPK8)
   05212 Pancreatic cancer
    108537794 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108537794 (MAPK8)
   05012 Parkinson disease
    108537794 (MAPK8)
   05016 Huntington disease
    108537794 (MAPK8)
   05017 Spinocerebellar ataxia
    108537794 (MAPK8)
   05020 Prion disease
    108537794 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    108537794 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108537794 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108537794 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    108537794 (MAPK8)
   04931 Insulin resistance
    108537794 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108537794 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108537794 (MAPK8)
   05135 Yersinia infection
    108537794 (MAPK8)
   05133 Pertussis
    108537794 (MAPK8)
   05152 Tuberculosis
    108537794 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108537794 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    108537794 (MAPK8)
   05161 Hepatitis B
    108537794 (MAPK8)
   05171 Coronavirus disease - COVID-19
    108537794 (MAPK8)
   05162 Measles
    108537794 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108537794 (MAPK8)
   05169 Epstein-Barr virus infection
    108537794 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108537794 (MAPK8)
   05142 Chagas disease
    108537794 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108537794 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108537794 (MAPK8)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108537794 (MAPK8)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108537794 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RIO1 APH Kdo FTA2 DUF530
Other DBs
NCBI-GeneID: 108537794
NCBI-ProteinID: XP_017740991
LinkDB
Position
Un
AA seq 405 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVWPALQVPSHPVIIFFLLVME
NYIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVEN
RPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYIN
VWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAA
VISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASTGPLGCCR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggctcaggagcgcaaggaatagta
tggcctgccttgcaggtcccatctcacccagtcattatattttttcttttggttatggag
aattacataattggccttttgaatgttttcacaccacagaaatccctagaagaatttcaa
gatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcagatggag
ctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaagcacctt
cactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaatctgac
tgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagttttatgatg
acgccttatgtagtgactcgctactacagagcacccgaggtcatccttggcatgggctac
aaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaaggtggt
gttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacagcttgga
acaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgttgaaaac
agacctaaatatgctggatatagcttcgagaaacttttccctgatgtacttttcccagct
gactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaaatgctg
gtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtacatcaat
gtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaagcagtta
gatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagttatggac
ttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggtgcagca
gtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtcttcaatg
tcaacagatccgactttggcctcggatacagacagcagtctagaagcatcaactgggcct
ctgggctgctgtagatga

DBGET integrated database retrieval system