KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517550Help
Entry
108517550         CDS       T04641                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00052  Galactose metabolism
rbb00500  Starch and sucrose metabolism
rbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108517550 (GANC)
   00500 Starch and sucrose metabolism
    108517550 (GANC)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108517550 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108517550
NCBI-ProteinID: XP_017711066
LinkDB All DBs
Position
Un
AA seq 964 aa AA seqDB search
MEAAEKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVTLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGGLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEAA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDEDAYRLYNLDVYGYQIFDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLSQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFRQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDTGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFITYIQKTWQTLALMYTHGSLLFSTCDCIPVALSPIGIFQWELLAKYKPSFQIQM
ATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIPMLLTLSITGI
SFCGADVGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGKEHTRLIREAI
RERYGLLPYWYSLFYYAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVHPVTEPK
ATTVDVFLPGSNEVWYDCKTFAHWEGGCTVKIPVALDTIPVFQRGGSVVPIKTTVGKSTG
WMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSVLINSSADQRG
HYPSKCVVEQILVLGLRKEPSFVTTHSSDGKDQPVAFTYCAKTSSLTLEKLSLNIATDWE
VHII
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaataagcgttgaagatgaagctgtggataaaaacatt
ttcagagactgcaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattactggactcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttactctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccaggtttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggacacagggagt
ctgatattggcagatggaaaaggaggcctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggcggca
tcagtggatacctctcaggaaaatcaagaggatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggtccttcttccattggtttggatttctccttgcat
ggatttgagcatctctatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatgaagatgcttaccgtctttataacctggatgtctatggataccaaatatttgac
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggcattttctggctgaatgcctcagaaacactggtggagatcaatacagagcctgcagta
gagtatacactgtcccagatgggcccagttgctgctaaacaaaaggtcagatctcgaact
catgtgcactggatgtcagaaagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcagacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggacgtaaaagca
gtggatacagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaaaagattcccaaaccccaagagg
atgcaagagctgctcagaagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aaccaggaaggggaagactttgaaggggtgtgctggccaggtctctcctcttatctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctaccgacatcctattcctttggaatgacatgaatgagccctctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagaactc
cacaacatctacggttttatcacctacatccaaaagacatggcagacacttgccctcatg
tatacccatggttctttgttattttcaacttgtgactgtattcctgtagccctctcacct
attggtattttccaatgggagcttttggctaaatataagcctagttttcagatacaaatg
gctactgcagaaggactgatacagcgatctaaagggaaggagagaccctttgttcttaca
cgttctttctttgctgggtcacagaagtatggtgctgtgtggacaggtgacaacacagca
gaatggagctacctgaaaatttctatcccaatgttactcactctcagcattactgggatc
tctttttgtggagctgacgtaggcgggttcattgggaatccagagacagagctgctagtg
cgttggtaccaggccggagcctaccagcccttcttccgtggccatgccaccatgaacacc
aagcgacgggagccctggctctttgggaaggaacacacccggctcatccgagaagccatc
agagagcgctatggcctcttgccatattggtattctctgttctactatgcacacgtggct
tcccaacctgtcatgaggcctctgtgggtagagttcccagatgaactaaagacttttgat
atggaagatgaatacatgctggggagtgcattattggttcatccagtcacagaaccaaaa
gccaccacagttgatgtgtttcttccaggatcaaatgaggtctggtatgactgtaagaca
tttgctcattgggaaggagggtgtactgtaaagatcccagtagccttggacactattcca
gtgtttcagcgaggtggaagtgtggtaccaataaagacaactgtaggaaaatccacaggc
tggatgactgaatcctcctatggacttcgggttgctctaagcactaagggttcttcagtg
ggtgagttatatcttgatgatggccattcattccagtacctccaccagaagcaatttttg
cacaggaagttttcattctgttccagtgttttgatcaatagttctgccgaccagagaggt
cattatcccagcaagtgtgtggtggagcagatcttggtcttaggcctcaggaaggagcca
tcttttgtgactacccactcatctgatggtaaagatcagcctgtggcttttacgtattgt
gccaaaacgtctagcctgaccctggagaagctctcgctcaacattgccactgactgggag
gtccacatcatatga

DBGET integrated database retrieval system