KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517746
Entry
108517746         CDS       T04641                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04613  Neutrophil extracellular trap formation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108517746 (PRKCA)
   04012 ErbB signaling pathway
    108517746 (PRKCA)
   04014 Ras signaling pathway
    108517746 (PRKCA)
   04015 Rap1 signaling pathway
    108517746 (PRKCA)
   04310 Wnt signaling pathway
    108517746 (PRKCA)
   04370 VEGF signaling pathway
    108517746 (PRKCA)
   04066 HIF-1 signaling pathway
    108517746 (PRKCA)
   04020 Calcium signaling pathway
    108517746 (PRKCA)
   04070 Phosphatidylinositol signaling system
    108517746 (PRKCA)
   04072 Phospholipase D signaling pathway
    108517746 (PRKCA)
   04071 Sphingolipid signaling pathway
    108517746 (PRKCA)
   04151 PI3K-Akt signaling pathway
    108517746 (PRKCA)
   04150 mTOR signaling pathway
    108517746 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108517746 (PRKCA)
   04540 Gap junction
    108517746 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108517746 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    108517746 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    108517746 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    108517746 (PRKCA)
   04670 Leukocyte transendothelial migration
    108517746 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    108517746 (PRKCA)
   04929 GnRH secretion
    108517746 (PRKCA)
   04912 GnRH signaling pathway
    108517746 (PRKCA)
   04921 Oxytocin signaling pathway
    108517746 (PRKCA)
   04926 Relaxin signaling pathway
    108517746 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    108517746 (PRKCA)
   04918 Thyroid hormone synthesis
    108517746 (PRKCA)
   04919 Thyroid hormone signaling pathway
    108517746 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    108517746 (PRKCA)
   04916 Melanogenesis
    108517746 (PRKCA)
   04925 Aldosterone synthesis and secretion
    108517746 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108517746 (PRKCA)
   04270 Vascular smooth muscle contraction
    108517746 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    108517746 (PRKCA)
   04971 Gastric acid secretion
    108517746 (PRKCA)
   04972 Pancreatic secretion
    108517746 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108517746 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108517746 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    108517746 (PRKCA)
   04727 GABAergic synapse
    108517746 (PRKCA)
   04725 Cholinergic synapse
    108517746 (PRKCA)
   04728 Dopaminergic synapse
    108517746 (PRKCA)
   04726 Serotonergic synapse
    108517746 (PRKCA)
   04720 Long-term potentiation
    108517746 (PRKCA)
   04730 Long-term depression
    108517746 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    108517746 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108517746 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    108517746 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108517746 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108517746 (PRKCA)
   05206 MicroRNAs in cancer
    108517746 (PRKCA)
   05205 Proteoglycans in cancer
    108517746 (PRKCA)
   05231 Choline metabolism in cancer
    108517746 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108517746 (PRKCA)
   05214 Glioma
    108517746 (PRKCA)
   05223 Non-small cell lung cancer
    108517746 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108517746 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    108517746 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    108517746 (PRKCA)
   05032 Morphine addiction
    108517746 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108517746 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108517746 (PRKCA)
   05161 Hepatitis B
    108517746 (PRKCA)
   05171 Coronavirus disease - COVID-19
    108517746 (PRKCA)
   05164 Influenza A
    108517746 (PRKCA)
   05163 Human cytomegalovirus infection
    108517746 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108517746 (PRKCA)
   05143 African trypanosomiasis
    108517746 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108517746 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108517746 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108517746 (PRKCA)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108517746 (PRKCA)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108517746 (PRKCA)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    108517746 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C APH Kinase-like
Other DBs
NCBI-GeneID: 108517746
NCBI-ProteinID: XP_017711327
LinkDB
Position
Un
AA seq 543 aa
MKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPN
GLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDR
TTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAK
LGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKI
LKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHI
QQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHM
MDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQS
IMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENRE
IQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQ
SAV
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaaatgtgacacctgcgatatgaacgttcacaagcagtgcgtcatcaatgtccccagc
ctctgtggaatggatcacacagagaagagggggcggatttacctaaaggctgaggttgct
gatgaaaagctccatgtcacagtacgagatgcaaaaaatctaatccctatggatccaaac
gggctttcagatccttatgtgaagctgaaacttattcctgatcccaagaatgaaagcaaa
caaaaaaccaaaaccatccgctccacactaaatccccagtggaatgagtcctttacattc
aaattgaaaccttcagacaaagaccgacgactgtctgtagaaatctgggactgggatcga
acaacaaggaatgacttcatgggatccctttcctttggggtttcggagctaatgaagatg
ccagccagtggatggtacaagttgcttaaccaagaagaaggtgagtactacaatgtaccc
attccagaaggggacgaagaaggaaacatggaactcaggcagaaattcgagaaagccaag
cttggccctgctggcaacaaagtcatcagtccctctgaagacaggaaacaaccttccaac
aacctggaccgagtgaaactcaccgacttcaatttcctcatggtgctggggaaggggagt
tttggaaaggtgatgcttgccgacaggaagggcacagaagaactgtacgcaatcaaaatc
ctgaagaaggatgtggtgattcaggatgatgacgtggagtgcaccatggtagaaaagcga
gtcttggccctgcttgacaaacccccattcttgacgcagctgcactcctgcttccagaca
gtggatcggctgtacttcgtcatggaatatgtcaacggtggggacctcatgtaccacatt
cagcaagtaggaaaatttaaggaaccacaagcagtattctatgcggcagagatttccatc
ggattgttctttcttcataaaagaggaatcatttatagggatctgaagttagataacgtc
atgttggattcagaaggacatatcaaaattgctgactttgggatgtgcaaggaacacatg
atggatggagtcacgaccaggaccttctgtgggactccagattacatcgccccagagatt
atcgcttatcagccatatggaaaatctgtggactggtgggcctatggcgtcctgttgtat
gaaatgcttgctgggcagcctccatttgatggtgaagatgaagatgagctatttcagtct
atcatggagcacaacgtttcctatccaaaatccttgtccaaggaggctgtttccatctgc
aaaggactgatgaccaaacacccagccaagcggctgggctgtgggcctgagggggagagg
gacgtgagagaacatgccttcttccggaggatcgactgggaaaaactggagaacagggag
atccagccaccattcaagcccaaagtgtgtggcaaaggagcagaaaactttgacaagttc
ttcacacgagggcagcccgtcttaacgccgcctgatcagctggttattgctaacatagac
cagtctgattttgaagggttctcgtatgtcaacccccagtttgtgcaccccatcttacag
agtgcagtatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529452
Entry
108529452         CDS       T04641                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04150  mTOR signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04613  Neutrophil extracellular trap formation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108529452 (PRKCG)
   04012 ErbB signaling pathway
    108529452 (PRKCG)
   04014 Ras signaling pathway
    108529452 (PRKCG)
   04015 Rap1 signaling pathway
    108529452 (PRKCG)
   04310 Wnt signaling pathway
    108529452 (PRKCG)
   04370 VEGF signaling pathway
    108529452 (PRKCG)
   04066 HIF-1 signaling pathway
    108529452 (PRKCG)
   04020 Calcium signaling pathway
    108529452 (PRKCG)
   04070 Phosphatidylinositol signaling system
    108529452 (PRKCG)
   04071 Sphingolipid signaling pathway
    108529452 (PRKCG)
   04150 mTOR signaling pathway
    108529452 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108529452 (PRKCG)
   04540 Gap junction
    108529452 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108529452 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    108529452 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    108529452 (PRKCG)
   04670 Leukocyte transendothelial migration
    108529452 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    108529452 (PRKCG)
   04929 GnRH secretion
    108529452 (PRKCG)
   04921 Oxytocin signaling pathway
    108529452 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    108529452 (PRKCG)
   04918 Thyroid hormone synthesis
    108529452 (PRKCG)
   04919 Thyroid hormone signaling pathway
    108529452 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    108529452 (PRKCG)
   04916 Melanogenesis
    108529452 (PRKCG)
   04925 Aldosterone synthesis and secretion
    108529452 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108529452 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    108529452 (PRKCG)
   04971 Gastric acid secretion
    108529452 (PRKCG)
   04972 Pancreatic secretion
    108529452 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108529452 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108529452 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    108529452 (PRKCG)
   04727 GABAergic synapse
    108529452 (PRKCG)
   04725 Cholinergic synapse
    108529452 (PRKCG)
   04728 Dopaminergic synapse
    108529452 (PRKCG)
   04726 Serotonergic synapse
    108529452 (PRKCG)
   04720 Long-term potentiation
    108529452 (PRKCG)
   04730 Long-term depression
    108529452 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    108529452 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108529452 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108529452 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108529452 (PRKCG)
   05206 MicroRNAs in cancer
    108529452 (PRKCG)
   05205 Proteoglycans in cancer
    108529452 (PRKCG)
   05231 Choline metabolism in cancer
    108529452 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108529452 (PRKCG)
   05214 Glioma
    108529452 (PRKCG)
   05223 Non-small cell lung cancer
    108529452 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108529452 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    108529452 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    108529452 (PRKCG)
   05032 Morphine addiction
    108529452 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108529452 (PRKCG)
   05161 Hepatitis B
    108529452 (PRKCG)
   05171 Coronavirus disease - COVID-19
    108529452 (PRKCG)
   05163 Human cytomegalovirus infection
    108529452 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108529452 (PRKCG)
   05143 African trypanosomiasis
    108529452 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108529452 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108529452 (PRKCG)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108529452 (PRKCG)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108529452 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 108529452
NCBI-ProteinID: XP_017727275
LinkDB
Position
Un
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggcgattcagagggaggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcaaggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaag
cacaagttccgcctgcatagctacagcagccctaccttctgcgaccactgtggctccctc
ctgtacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacacggagcgccgcgggcgc
ctgcagctagagatccgggctcccactgcagatgagatccacataacggttggcgaggcc
cgtaaccttattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaatctgacgaaacagaaaacccgaacggtgaaagccacgctaaat
cctgtgtggaatgagacctttgtgttcaacctgaagcctggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtct
tttggcgtctcggagctgctcaaggcgccagtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcaagcccaggacgtctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaaa
atcctgaaaaaggacgtgatcgtccaggacgacgacgtggactgcacgctggtggagaaa
cgcgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccaactc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcacgggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctctatgagatgttggcaggacagcctcccttcgatggggaggatgaa
gaagagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttctcgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcggctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggaa
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctaacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccaggggtttacctacgtgaaccccgacttc
gtgcatccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538857
Entry
108538857         CDS       T04641                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04150  mTOR signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04613  Neutrophil extracellular trap formation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04931  Insulin resistance
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108538857 (PRKCB)
   04012 ErbB signaling pathway
    108538857 (PRKCB)
   04014 Ras signaling pathway
    108538857 (PRKCB)
   04015 Rap1 signaling pathway
    108538857 (PRKCB)
   04310 Wnt signaling pathway
    108538857 (PRKCB)
   04370 VEGF signaling pathway
    108538857 (PRKCB)
   04064 NF-kappa B signaling pathway
    108538857 (PRKCB)
   04066 HIF-1 signaling pathway
    108538857 (PRKCB)
   04020 Calcium signaling pathway
    108538857 (PRKCB)
   04070 Phosphatidylinositol signaling system
    108538857 (PRKCB)
   04071 Sphingolipid signaling pathway
    108538857 (PRKCB)
   04150 mTOR signaling pathway
    108538857 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108538857 (PRKCB)
   04540 Gap junction
    108538857 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108538857 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    108538857 (PRKCB)
   04662 B cell receptor signaling pathway
    108538857 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    108538857 (PRKCB)
   04670 Leukocyte transendothelial migration
    108538857 (PRKCB)
   04062 Chemokine signaling pathway
    108538857 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    108538857 (PRKCB)
   04929 GnRH secretion
    108538857 (PRKCB)
   04912 GnRH signaling pathway
    108538857 (PRKCB)
   04921 Oxytocin signaling pathway
    108538857 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    108538857 (PRKCB)
   04918 Thyroid hormone synthesis
    108538857 (PRKCB)
   04919 Thyroid hormone signaling pathway
    108538857 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    108538857 (PRKCB)
   04916 Melanogenesis
    108538857 (PRKCB)
   04925 Aldosterone synthesis and secretion
    108538857 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108538857 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    108538857 (PRKCB)
   04971 Gastric acid secretion
    108538857 (PRKCB)
   04972 Pancreatic secretion
    108538857 (PRKCB)
   04973 Carbohydrate digestion and absorption
    108538857 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108538857 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108538857 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    108538857 (PRKCB)
   04727 GABAergic synapse
    108538857 (PRKCB)
   04725 Cholinergic synapse
    108538857 (PRKCB)
   04728 Dopaminergic synapse
    108538857 (PRKCB)
   04726 Serotonergic synapse
    108538857 (PRKCB)
   04720 Long-term potentiation
    108538857 (PRKCB)
   04730 Long-term depression
    108538857 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    108538857 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108538857 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108538857 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538857 (PRKCB)
   05206 MicroRNAs in cancer
    108538857 (PRKCB)
   05205 Proteoglycans in cancer
    108538857 (PRKCB)
   05231 Choline metabolism in cancer
    108538857 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108538857 (PRKCB)
   05214 Glioma
    108538857 (PRKCB)
   05223 Non-small cell lung cancer
    108538857 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108538857 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    108538857 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    108538857 (PRKCB)
   05032 Morphine addiction
    108538857 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108538857 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108538857 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108538857 (PRKCB)
   05161 Hepatitis B
    108538857 (PRKCB)
   05171 Coronavirus disease - COVID-19
    108538857 (PRKCB)
   05164 Influenza A
    108538857 (PRKCB)
   05163 Human cytomegalovirus infection
    108538857 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108538857 (PRKCB)
   05140 Leishmaniasis
    108538857 (PRKCB)
   05143 African trypanosomiasis
    108538857 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108538857 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108538857 (PRKCB)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108538857 (PRKCB)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108538857 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like CEP76-C2 APH C1_2
Other DBs
NCBI-GeneID: 108538857
NCBI-ProteinID: XP_017742664
LinkDB
Position
Un
AA seq 677 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDMACEMHSHNQCLLNMPSLIGVNHSAKRGHYLLLYLLSLLKQLKIHKT
IRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDK
DRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSE
GNEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGSRDRMKLTDFNFLMVLGKGSFGKV
MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRL
YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDS
EGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA
GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE
HAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEF
EGFSFVNSEFLKPEVKS
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaatgtgcacgaggtcaagaaccacaaatttacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagtcccacgttttgtgaccactgtgggtca
ttgctgtatggactcatccaccaggggatgaaatgtgacatggcatgtgagatgcacagt
cacaatcagtgcctcctgaatatgccatcattgataggggtaaatcatagtgcaaaaagg
gggcattatctgcttctttatctactctctctcctgaagcaactgaagatccacaaaaca
ataagagatgctaaaaaccttgtacctatggaccccaatggcctgtcagatccctacgta
aaactgaaactgattcctgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaa
tgctccctcaaccctgagtggaacgagacatttagatttcagctgaaagagtcggacaaa
gacagacgactgtcagtagagatttgggattgggatttgaccagcaggaatgacttcatg
ggatctttgtcctttgggatttctgaacttcagaaagccagtgttgatggctggtttaag
ttactgagccaggaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgag
ggcaatgaagaactgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtc
ccagaagaaaagacgaccaatactgtctccaaatttgacaacaatggcagcagagaccgg
atgaaactgactgattttaacttcctaatggtgctggggaaaggcagctttggcaaggtc
atgctttcagaacgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggat
gtcgtgatccaagatgatgacgtggagtgcactatggtggagaagcgggtgctggccctg
cccgggaagccgcccttcctgacccagctccactcctgcttccagaccatggaccgcctg
tactttgtgatggagtatgtcaacgggggcgacctcatgtatcacatccagcaagttggc
cggttcaaggagccccatgctgtattttacgctgcagaaattgccatcggtctgttcttc
ttacagagtaagggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattct
gaggggcacatcaagattgctgattttggcatgtgtaaggagaacatctgggatggggtg
acaaccaagacattctgtggcactccagactacatcgcccctgagataattgcttatcag
ccctatgggaagtccgtggattggtgggcatttggagtcctgctgtatgaaatgttggct
gggcaggcaccctttgaaggggaagatgaagatgaactcttccagtccatcatggaacac
aacgtagcctatcccaagtctatgtccaaggaagctgtggccatctgcaaaggactgatg
accaaacacccgggcaaacgtttgggttgtggacctgaaggcgaacgtgatatcaaagag
catgcatttttccggtatattgattgggagaaacttgaacgcaaagagatccagccccca
tataagccaaaagcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccat
ccaccagtcctaacacctcccgaccaggaagtcatcaggaatattgaccaatcagaattc
gaaggattttcctttgttaactctgaatttttaaaacccgaagtcaagagctaa

DBGET integrated database retrieval system