KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517986
Entry
108517986         CDS       T04641                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb04270  Vascular smooth muscle contraction
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04613  Neutrophil extracellular trap formation
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05132  Salmonella infection
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108517986 (RAF1)
   04012 ErbB signaling pathway
    108517986 (RAF1)
   04014 Ras signaling pathway
    108517986 (RAF1)
   04015 Rap1 signaling pathway
    108517986 (RAF1)
   04370 VEGF signaling pathway
    108517986 (RAF1)
   04371 Apelin signaling pathway
    108517986 (RAF1)
   04630 JAK-STAT signaling pathway
    108517986 (RAF1)
   04068 FoxO signaling pathway
    108517986 (RAF1)
   04072 Phospholipase D signaling pathway
    108517986 (RAF1)
   04071 Sphingolipid signaling pathway
    108517986 (RAF1)
   04024 cAMP signaling pathway
    108517986 (RAF1)
   04022 cGMP-PKG signaling pathway
    108517986 (RAF1)
   04151 PI3K-Akt signaling pathway
    108517986 (RAF1)
   04150 mTOR signaling pathway
    108517986 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108517986 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    108517986 (RAF1)
   04218 Cellular senescence
    108517986 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108517986 (RAF1)
   04540 Gap junction
    108517986 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108517986 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108517986 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108517986 (RAF1)
   04625 C-type lectin receptor signaling pathway
    108517986 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    108517986 (RAF1)
   04660 T cell receptor signaling pathway
    108517986 (RAF1)
   04662 B cell receptor signaling pathway
    108517986 (RAF1)
   04664 Fc epsilon RI signaling pathway
    108517986 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    108517986 (RAF1)
   04062 Chemokine signaling pathway
    108517986 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108517986 (RAF1)
   04929 GnRH secretion
    108517986 (RAF1)
   04912 GnRH signaling pathway
    108517986 (RAF1)
   04915 Estrogen signaling pathway
    108517986 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    108517986 (RAF1)
   04917 Prolactin signaling pathway
    108517986 (RAF1)
   04921 Oxytocin signaling pathway
    108517986 (RAF1)
   04926 Relaxin signaling pathway
    108517986 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    108517986 (RAF1)
   04919 Thyroid hormone signaling pathway
    108517986 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    108517986 (RAF1)
   04916 Melanogenesis
    108517986 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108517986 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    108517986 (RAF1)
   04720 Long-term potentiation
    108517986 (RAF1)
   04730 Long-term depression
    108517986 (RAF1)
   04722 Neurotrophin signaling pathway
    108517986 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    108517986 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108517986 (RAF1)
   05206 MicroRNAs in cancer
    108517986 (RAF1)
   05205 Proteoglycans in cancer
    108517986 (RAF1)
   05230 Central carbon metabolism in cancer
    108517986 (RAF1)
   05231 Choline metabolism in cancer
    108517986 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108517986 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108517986 (RAF1)
   05212 Pancreatic cancer
    108517986 (RAF1)
   05225 Hepatocellular carcinoma
    108517986 (RAF1)
   05226 Gastric cancer
    108517986 (RAF1)
   05214 Glioma
    108517986 (RAF1)
   05221 Acute myeloid leukemia
    108517986 (RAF1)
   05220 Chronic myeloid leukemia
    108517986 (RAF1)
   05218 Melanoma
    108517986 (RAF1)
   05211 Renal cell carcinoma
    108517986 (RAF1)
   05219 Bladder cancer
    108517986 (RAF1)
   05215 Prostate cancer
    108517986 (RAF1)
   05213 Endometrial cancer
    108517986 (RAF1)
   05224 Breast cancer
    108517986 (RAF1)
   05223 Non-small cell lung cancer
    108517986 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108517986 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    108517986 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    108517986 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108517986 (RAF1)
   05152 Tuberculosis
    108517986 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108517986 (RAF1)
   05161 Hepatitis B
    108517986 (RAF1)
   05160 Hepatitis C
    108517986 (RAF1)
   05164 Influenza A
    108517986 (RAF1)
   05163 Human cytomegalovirus infection
    108517986 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108517986 (RAF1)
   05165 Human papillomavirus infection
    108517986 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108517986 (RAF1)
   01522 Endocrine resistance
    108517986 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108517986 (RAF1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108517986 (RAF1)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108517986 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 108517986
NCBI-ProteinID: XP_017711600
UniProt: A0A2K6KHX9
LinkDB
Position
Un
AA seq 668 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTLVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNNLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVNPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggattcaaagatgcc
gtgtttgatggctccagctgcatctctcctacattagttcagcagtttggctatcagcgc
cgggcatcagatgatggcaaactcacagatccttctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggccttcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgcttagattggaatactgatgctgcctct
ttgattggggaagaacttcaagtagatttcctggatcatgttccgcttacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcaaacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgtttccaaattccact
attggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtct
gtttccaggatgcctgttagttctcagcacaggtattctacacctcacgccttcaccttt
aacacctccagtccctcatctgaaggttccctgtcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgagaataac
aacctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctg
agcccaacaggctggtcacagccgaaaacacccgtgccagcacaaagagagcgggcacca
gtatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctgtccactcggattgggtcaggctctttt
ggaactgtttataagggcaaatggcatggagacgttgcagtaaagatcctaaaggttgtc
aacccaaccccagagcaattccaggccttcaggaatgaggtggctgttctgcgcaaaaca
cggcatgtgaacattctgcttttcatggggtacatgacaaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttt
cagatgttccagctaattgacattgcccgacagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacctactggctctgtcctgtggatggccccagaggtgatccgaatgcag
gataacaacccattcagtttccagtcggatgtctactcctatggcatcgtattatatgag
ctgatgacgggggaacttccttactctcacatcaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcctccccagatcttagtaagctatataagaactgccccaaagca
atgaagaggctggtagctgactgtgtgaagaaagtaaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaagatcaaccggagcgct
tccgagccatccttgcatcgggcagcccacactgaggatatcaatgcttgcacgctgacc
acgtcccctaggctgcctgtcttctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530908
Entry
108530908         CDS       T04641                                 

Gene name
ARAF
Definition
(RefSeq) A-Raf proto-oncogene, serine/threonine kinase
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04068  FoxO signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04650  Natural killer cell mediated cytotoxicity
rbb04720  Long-term potentiation
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108530908 (ARAF)
   04012 ErbB signaling pathway
    108530908 (ARAF)
   04068 FoxO signaling pathway
    108530908 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108530908 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108530908 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108530908 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    108530908 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    108530908 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108530908 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    108530908 (ARAF)
   04720 Long-term potentiation
    108530908 (ARAF)
   04730 Long-term depression
    108530908 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530908 (ARAF)
   05205 Proteoglycans in cancer
    108530908 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108530908 (ARAF)
   05212 Pancreatic cancer
    108530908 (ARAF)
   05225 Hepatocellular carcinoma
    108530908 (ARAF)
   05226 Gastric cancer
    108530908 (ARAF)
   05214 Glioma
    108530908 (ARAF)
   05221 Acute myeloid leukemia
    108530908 (ARAF)
   05220 Chronic myeloid leukemia
    108530908 (ARAF)
   05218 Melanoma
    108530908 (ARAF)
   05211 Renal cell carcinoma
    108530908 (ARAF)
   05219 Bladder cancer
    108530908 (ARAF)
   05215 Prostate cancer
    108530908 (ARAF)
   05213 Endometrial cancer
    108530908 (ARAF)
   05224 Breast cancer
    108530908 (ARAF)
   05223 Non-small cell lung cancer
    108530908 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108530908 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    108530908 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    108530908 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108530908 (ARAF)
   05160 Hepatitis C
    108530908 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108530908 (ARAF)
   01522 Endocrine resistance
    108530908 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108530908 (ARAF)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108530908 (ARAF)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108530908 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 108530908
NCBI-ProteinID: XP_017729524
UniProt: A0A2K6KC69
LinkDB
Position
Un
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELL
TPQGPRPHTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFS
TDAASSRGGGDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacagtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgtcccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccaacagttctaccacagtgtccaggat
ttgtccggaggctccagacaacatgaggctccctcgaaccgccccctgaatgagttgcta
accccccagggtcccaggccccacactcagcactgtgacccggagcacttccccttccct
gccccggccaacgcccccctgcagcgcatccgctccacatccactcccaacgtccatatg
gtcagcaccacggcccccatggactccaacctcatccagctcactggccagagtttcagc
actgatgctgccagtagtagaggaggtggtgatggaaccccccgggggagccccagccca
gccagcgtgtcctcggggaggaaatccccacattccaagtcaccagcagagcagcgtgag
cggaagtccttggccgatgacaagaagaaagtgaagaacctggggtaccgggactcaggc
tattactgggaggtaccacccagtgaggtgcagctgctgaagaggatcgggacgggctcg
tttggcaccgtgtttcgagggcggtggcatggcgatgtggctgtgaaggtgctcaaggtg
tcccagcccaccgctgagcaggcccaagctttcaagaatgagatgcaggtgctcaggaag
acgcgacatgtcaacatcttgctgtttatgggcttcatgacccggccgggatttgccatc
atcacacagtggtgtgaaggctccagcctctaccatcacctgcatgtggctgacacacgc
ttcgacatggtccagctcatcgacgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctacatgagggg
ctcacggtgaagatcggtgactttggcttggccacagtgaagactcgatggagcggggcc
cagcccttggagcagccctcaggctctgtgctgtggatggcagctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcagatgtctatgcctacggggttgtgctctac
gagctcatgactggctcactgccttacagccacattggctgccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctctagcaactgccccaag
gccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggaacggcccctcttc
ccccagatcctggccacaattgagctgctgcaacggtcactccccaagattgagcggagt
gcctcggaaccctccttgcaccgcacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgtcttgtgccttag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541537
Entry
108541537         CDS       T04641                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04068  FoxO signaling pathway
rbb04150  mTOR signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04510  Focal adhesion
rbb04650  Natural killer cell mediated cytotoxicity
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108541537 (BRAF)
   04012 ErbB signaling pathway
    108541537 (BRAF)
   04015 Rap1 signaling pathway
    108541537 (BRAF)
   04068 FoxO signaling pathway
    108541537 (BRAF)
   04024 cAMP signaling pathway
    108541537 (BRAF)
   04150 mTOR signaling pathway
    108541537 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108541537 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108541537 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108541537 (BRAF)
   04062 Chemokine signaling pathway
    108541537 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108541537 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    108541537 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    108541537 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108541537 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    108541537 (BRAF)
   04720 Long-term potentiation
    108541537 (BRAF)
   04730 Long-term depression
    108541537 (BRAF)
   04722 Neurotrophin signaling pathway
    108541537 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108541537 (BRAF)
   05205 Proteoglycans in cancer
    108541537 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108541537 (BRAF)
   05212 Pancreatic cancer
    108541537 (BRAF)
   05225 Hepatocellular carcinoma
    108541537 (BRAF)
   05226 Gastric cancer
    108541537 (BRAF)
   05214 Glioma
    108541537 (BRAF)
   05216 Thyroid cancer
    108541537 (BRAF)
   05221 Acute myeloid leukemia
    108541537 (BRAF)
   05220 Chronic myeloid leukemia
    108541537 (BRAF)
   05218 Melanoma
    108541537 (BRAF)
   05211 Renal cell carcinoma
    108541537 (BRAF)
   05219 Bladder cancer
    108541537 (BRAF)
   05215 Prostate cancer
    108541537 (BRAF)
   05213 Endometrial cancer
    108541537 (BRAF)
   05224 Breast cancer
    108541537 (BRAF)
   05223 Non-small cell lung cancer
    108541537 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108541537 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    108541537 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    108541537 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108541537 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108541537 (BRAF)
   05160 Hepatitis C
    108541537 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108541537 (BRAF)
   01522 Endocrine resistance
    108541537 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108541537 (BRAF)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108541537 (BRAF)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108541537 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 108541537
NCBI-ProteinID: XP_017746540
LinkDB
Position
Un
AA seq 753 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAAASSAADPAVPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEYLGNGTDFSVSSSASMDTVTSSS
SSSLSVLQSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKAL
MMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTL
AFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEA
SLAETALTSGSSPSAPTSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSS
APNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKML
NVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWS
GSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQI
IFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQENLQPSSSHHHGSICS
YFLSLVFVQFVNIKTQFCSSNFFLKIQNFQCIS
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccctgccgttccg
gaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcccta
ttggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaa
tacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatatctgggg
aacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatcttcttcc
tcttctagcctttcagtgctacaatctctttcagtttttcaaaatcccacagatgtggca
cggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctacccaacaaacag
aggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaagaaagcactg
atgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaag
aaaccaattggctgggacactgatatttcctggcttactggagaagaattgcatgtggaa
gtgttggagaatgttccacttacaacacacaactttgtacgaaaaacatttttcacctta
gcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgtggt
tataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaa
cttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaagaggcc
tccttagcagagactgccctaacatctggatcatccccttccgcacccacctcagactct
attgggccccaaattctcaccagtccgtctccttcaaaatccattccaattccacagccc
ttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccggtcctcatca
gctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttgattagagac
caaggatttcgtggtgatggaggatcaaccacaggtttgtctgccaccccccctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcgagaa
aggaagtcatcttcatcctcagaagacaggaatcggatgaaaacacttggtagacgggac
tcgagtgatgattgggagattcctgatgggcagattacagtgggacaaagaattggatct
gggtcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttg
aatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagtaggagtactc
aggaaaacacgacacgtgaatatcctactcttcatgggctattccacaaagccacaacta
gctattgttacccagtggtgcgagggctccagcttgtatcaccatctccatatcattgag
accaaatttgagatgatcaaacttatagatattgcacgacagactgcacagggcatggat
tacttacacgccaagtcaatcatccacagagacctcaagagtaataatatatttcttcat
gaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatctcgatggagt
gggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagtcatc
agaatgcaagataaaaatccatacagctttcagtcggatgtatatgcctttgggattgtt
ctgtatgaattgatgactggacagttaccttattcaaacatcaataacagggaccagata
atttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagtaactgt
ccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagatgaaagacca
ctctttccccaagagaatttgcagccttcaagtagccaccatcatggcagcatctgctct
tatttcttaagtcttgtgttcgtacaatttgttaacatcaaaacacagttctgttcctca
aatttttttttaaagatacaaaatttccaatgcataagctga

DBGET integrated database retrieval system