KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518065
Entry
108518065         CDS       T04641                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04068  FoxO signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108518065 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    108518065 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108518065 (BCL2L11)
   04215 Apoptosis - multiple species
    108518065 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108518065 (BCL2L11)
   05206 MicroRNAs in cancer
    108518065 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108518065 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108518065 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    108518065 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108518065 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact PMAIP1
Other DBs
NCBI-GeneID: 108518065
NCBI-ProteinID: XP_017711698
LinkDB
Position
Un
AA seq 206 aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVMMFSLPPFLLTPS
PSTPYFLKKTVTCCNYMLILEMNTVA
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttctgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagaggcctccccagctcagacctggggcccctacctccctacagacagaacca
caaggtaatcccgaagacaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccaccggccagccctggcccttttgctaccagatccccgcttttc
atctttatgagaagatcctccctgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccaggaggcaggctgaacctgca
gatatgcgcccggagatacggatcgcccaagagttgcggcgaatcggagacgagtttaac
gcttactatgcaaggagggtaatgatgttttctttacccccttttctgctcacgccctcc
ccttccacaccatattttttaaaaaagacagtgacttgttgtaactacatgctaattcta
gaaatgaatactgttgcctag

DBGET integrated database retrieval system