KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518204
Entry
108518204         CDS       T04641                                 

Gene name
SLC9A1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04024  cAMP signaling pathway
rbb04260  Cardiac muscle contraction
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04371  Apelin signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04919  Thyroid hormone signaling pathway
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04976  Bile secretion
rbb05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108518204 (SLC9A1)
   04024 cAMP signaling pathway
    108518204 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108518204 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108518204 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108518204 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    108518204 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    108518204 (SLC9A1)
   04971 Gastric acid secretion
    108518204 (SLC9A1)
   04972 Pancreatic secretion
    108518204 (SLC9A1)
   04976 Bile secretion
    108518204 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108518204 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108518204 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108518204 (SLC9A1)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108518204 (SLC9A1)
Transporters [BR:rbb02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   108518204 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 108518204
NCBI-ProteinID: XP_017711928
UniProt: A0A2K6K0U1
LinkDB
Position
Un
AA seq 815 aa
MFLRSGICGLSPPRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGVKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVVEEDEEDDGGIMMRSKEPSTPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgtttctgcggtctggcatctgtggcctctctccacctcggatcttcccttccttgctc
gtggtggtcgctttggtggggctgctccctgttctcaggagccatggcctccagctcagc
ccaactgccagcaccattcgaagctcagagccaccacgagaacgctcgattggagatgtc
accaccgctccaccggaggtcaccccagagagccgccctgttaatcattccgtcactgat
catggcgtgaagccgcgcaaggcctttccagtcctgggcatcgactacacacacgtgcgc
acccccttcgagatctccctctggatccttctggcctgcctcatgaagataggtttccat
gtgatccccactatctcaagcatcgtcccggagagctgcctgctgatcgtggtggggctg
ctggtggggggcctgatcaagggtgtaggcgagacaccccccttcctgcagtccgacgtc
ttcttcctcttcctgctgccgcccatcatcctggacgcgggctacttcctgccgctgcgg
cagttcacagaaaacctgggcaccatcctgatctttgccgtggtgggcacactgtggaac
gccttcttcctggggggactcatgtacgccgtgtgcctggtgggcggtgagcagatcaac
aacatcggcctcctggacaacctgctcttcggcagcatcatctcggccgtggaccccgtg
gcggttctggctgtctttgaggaaattcacatcaatgagctgctgcacatccttgtcttt
ggggagtccttgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactatgagcacgtgggcatcgtggacatcttcctcggcttcctgagcttcttcgtg
gtggccctgggcggggtgtttgtgggcgtggtctacggggtcatcgcagccttcacctcc
cgatttacctcgcacatccgggtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacttgtcagccgagctcttccacctgtcaggcatcatggcgcttatagcctcagga
gtggtgatgcgcccctatgtggaggccaacatctcccacaagtcccacaccaccatcaaa
tacttcctgaagatgtggagcagcgtcagtgagaccctcatcttcatcttccttggtgtc
tccacggtggccggctcccaccactggaactggaccttcgtcatcagcaccctgctcttc
tgcctcatcgcccgcgtgctgggcgtgctgggcttgacctggttcatcaacaagttccgc
atcgtgaagctgacccccaaggaccagttcatcatcgcctatgggggcctgcgaggggcc
atcgccttctctctgggctacctcctggacaagaagcacttccctatgtgtgacctgttc
ctcactgccatcatcactgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacctgttggctgtgaagaaaaagcaagagacgaagcgctccatcaacgag
gagatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggtcaccaccactggaaggacaagctcaaccggtttaataagaaatacgtgaagaag
tgtctgatagccggcgagcgctccaaggagccccaactcatcgccttctaccacaagatg
gagatgaagcaggccatcgagctggtggagagcgggggcatgggcaagatcccctccgcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgccttccgagcgcatcctg
ccggcactgtccaaggacaaggaggaggagatccgcaaaatcctgaggaacaacttgcag
aagaccaggcagcggctgcggtcctacaacagacacacgctggtggcggacccctacgag
gaagcctggaaccagatgctgctccggaggcagaaggcccggcagctggagcagaagatc
aacaactacctgacagtgccagcccacaagctggactcacccaccatgtctcgggcccgc
atcggctcagacccactggcctatgagccgaaggaggacctgcctgtcatcaccatcgac
ccggcctccccgcagtcacccgagtctgtggacctggtgaacgaggagctgaagggcaag
gtcttggggttgagccgggatcctgcgaaggtggtcgaggaggacgaggaggacgatggg
ggtatcatgatgcggagcaaggagccttcgaccccaggaaccgacgatgtcttcaccccc
gcacccagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggcccg
caccctgagcctggggagggagagccgttcatccctaaggggcagtag

DBGET integrated database retrieval system