KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518478
Entry
108518478         CDS       T04641                                 

Gene name
NCF4
Definition
(RefSeq) neutrophil cytosolic factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04670  Leukocyte transendothelial migration
rbb05020  Prion disease
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108518478 (NCF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108518478 (NCF4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108518478 (NCF4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    108518478 (NCF4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108518478 (NCF4)
Membrane trafficking [BR:rbb04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108518478 (NCF4)
SSDB
Motif
Pfam: PX PB1 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 108518478
NCBI-ProteinID: XP_017712391
UniProt: A0A2K6MY14
LinkDB
Position
Un
AA seq 339 aa
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTVKDIAVEEDLSSTPLFKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVVLMVRKARGLPSQKRLFPWKLHITQKDNYRVYNTMP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctgtggcccagcagctgcgggccgagagtgactttgaacagcttccagatgatgtt
gccatctcagccaacatcgccgacatcgaggagaagagaggcttcaccagtcactttgtt
ttcgtcatcgaggtgaagacgaaaggaggatccaagtacctcatctaccgccgctaccgc
cagttccatgctttgcagagcaagctggaggagcgcttcgggccagacagcaagagcagc
gccctggcctgtaccctgcccacactcccagccaaagtctacgtgggtgtgaaacaggag
atcgccgagatgcggatacctgccctcaacgcctacatgaagagcctgctcagcctgcca
gtctgggtgctgatggatgaggacgtccggatcttcttttaccagtcgccctatgactca
gagcaggtgccccaggcactccgccggctccgcccgcgcacccggaaagtcaagagcgta
tccccacaaggcaacagcgttgaccgcatggcagctccgagagcagaggctctatttgac
ttcactggaaacagcaaactggagctgaatttcaaagccggagatgtgatcttccttctc
agtcggatcaacaaagactggctggagggcactgtccggggagccacaggcatcttccct
ctctccttcgtgaagatcctcaaagacttccctgaggaggacgaccccaccaactggctg
cgctgctactactatgaagacactatcagcaccgtcaaggacatcgcagtggaggaagat
cttagcagcactcccctattcaaagacctgctggagctcacgaggcgggagttccagagg
gaggacatcgccctgaattaccgggacgctgagggggatctggttcggctgctgtcggat
gaagacgtggtgcttatggtacggaaggctcgcggcctcccctcccagaagcgtctcttt
ccctggaagctgcatatcacgcagaaggacaactacagggtctacaacacgatgccatga

DBGET integrated database retrieval system