KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518621
Entry
108518621         CDS       T04641                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04012  ErbB signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04350  TGF-beta signaling pathway
rbb04371  Apelin signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04714  Thermogenesis
rbb04910  Insulin signaling pathway
rbb04931  Insulin resistance
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05221  Acute myeloid leukemia
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108518621 (RPS6KB2)
   04350 TGF-beta signaling pathway
    108518621 (RPS6KB2)
   04371 Apelin signaling pathway
    108518621 (RPS6KB2)
   04066 HIF-1 signaling pathway
    108518621 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    108518621 (RPS6KB2)
   04152 AMPK signaling pathway
    108518621 (RPS6KB2)
   04150 mTOR signaling pathway
    108518621 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108518621 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108518621 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108518621 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    108518621 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    108518621 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    108518621 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108518621 (RPS6KB2)
   05205 Proteoglycans in cancer
    108518621 (RPS6KB2)
   05231 Choline metabolism in cancer
    108518621 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108518621 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108518621 (RPS6KB2)
   05212 Pancreatic cancer
    108518621 (RPS6KB2)
   05225 Hepatocellular carcinoma
    108518621 (RPS6KB2)
   05226 Gastric cancer
    108518621 (RPS6KB2)
   05221 Acute myeloid leukemia
    108518621 (RPS6KB2)
   05224 Breast cancer
    108518621 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108518621 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108518621 (RPS6KB2)
   05163 Human cytomegalovirus infection
    108518621 (RPS6KB2)
   05165 Human papillomavirus infection
    108518621 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108518621 (RPS6KB2)
   01522 Endocrine resistance
    108518621 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108518621 (RPS6KB2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108518621 (RPS6KB2)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   108518621 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Pkinase_fungal Kinase-like Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 108518621
NCBI-ProteinID: XP_017712639
LinkDB
Position
Un
AA seq 437 aa
MPGLDALVSNQFLCLQAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLI
LECLSGGELFMHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGH
IKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSA
SPAPWEEEGRGRGGRSPPYWGKGRAWWEAHKAPLTFLILQPPFTAENRKKTMDKIIKGKL
ALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLARRVDPPFR
PCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQP
KLRSPRRLNSSPRAPISPLKFSPFEGFRPSPSLPEPVEPPLPPLLPPPPPPSITAPLPIR
PPSGTKKSKRGRGRPGR
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcccggcctggatgccctagtttctaaccaattcctgtgtctccaggccaaaattgtg
cgcaacgccaaggacacagcacacacacgggctgagcggaacattctagagtctgtgaag
catccctttattgtggaactggcctatgccttccagactggtggcaaactctacctcatc
cttgagtgcctcagtggtggcgagctcttcatgcatctggagcgagagggcatcttcctg
gaagatacagcctgcttctacctggccgagatcacgctggccctgggccatctccactcc
cagggcatcatctaccgggacctcaagcccgagaacatcatgctcagcagccagggccac
atcaaactgactgactttggactctgcaaggagtcgatccatgagggcgccgtcactcac
accttctgcggcaccattgagtacatggcccctgagattctggtgcgcagtggccacaac
cgggctgtggactggtggagcctgggggccctgatgtacgacatgctcactggatcggca
agtccagcgccctgggaggaggagggcaggggcaggggtgggaggagccccccctactgg
ggcaagggcagggcctggtgggaggcccacaaggctcctctcaccttcctcatcctccag
ccccccttcactgcagagaaccggaagaaaaccatggataagatcatcaagggcaagctg
gcgctgcccccctacctcaccccagatgcccgggaccttgtcaaaaagtttctgaaacgg
aatcccagccagaggattgggggtggtccaggggatgctgctgatgtgcagaggcatccc
tttttccggcacatgaattgggacgaccttctggcccggcgtgtggacccccctttcagg
ccctgtctgcagtcagaggaggacgtgagccagtttgatacccgcttcacacggcagacg
ccggtggacagtcccgatgacacggccctcagcgagagtgccaaccaggccttcctgggc
ttcacgtacgtggcgccgtctgtcctggacagcatcaaggagggcttctccttccagccc
aagctgcgctcacccaggcgcctcaacagtagcccccgggcccccatcagccccctcaag
ttctccccctttgaggggtttcggcccagccccagcctgccggagcccgtggagccacct
ctacctccactcctgccaccgccaccaccaccctcgatcaccgcccctctccccatccgt
cccccctcagggaccaagaagtccaagaggggccgtgggcgtccaggacgctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533071
Entry
108533071         CDS       T04641                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04012  ErbB signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04350  TGF-beta signaling pathway
rbb04371  Apelin signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04714  Thermogenesis
rbb04910  Insulin signaling pathway
rbb04931  Insulin resistance
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05221  Acute myeloid leukemia
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108533071 (RPS6KB1)
   04350 TGF-beta signaling pathway
    108533071 (RPS6KB1)
   04371 Apelin signaling pathway
    108533071 (RPS6KB1)
   04066 HIF-1 signaling pathway
    108533071 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    108533071 (RPS6KB1)
   04152 AMPK signaling pathway
    108533071 (RPS6KB1)
   04150 mTOR signaling pathway
    108533071 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108533071 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108533071 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108533071 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    108533071 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    108533071 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    108533071 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108533071 (RPS6KB1)
   05205 Proteoglycans in cancer
    108533071 (RPS6KB1)
   05231 Choline metabolism in cancer
    108533071 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108533071 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108533071 (RPS6KB1)
   05212 Pancreatic cancer
    108533071 (RPS6KB1)
   05225 Hepatocellular carcinoma
    108533071 (RPS6KB1)
   05226 Gastric cancer
    108533071 (RPS6KB1)
   05221 Acute myeloid leukemia
    108533071 (RPS6KB1)
   05224 Breast cancer
    108533071 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108533071 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108533071 (RPS6KB1)
   05163 Human cytomegalovirus infection
    108533071 (RPS6KB1)
   05165 Human papillomavirus infection
    108533071 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108533071 (RPS6KB1)
   01522 Endocrine resistance
    108533071 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108533071 (RPS6KB1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108533071 (RPS6KB1)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   108533071 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 108533071
NCBI-ProteinID: XP_017732942
LinkDB
Position
Un
AA seq 481 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKAMIVRNAKDTAHTKAE
RNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEIS
MALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCELVIHDQQSHHHFVEQMNTCELR
MLSRIGLGRPLKSLMKGGHKSVLLRFCLPYLTPSKPENLLKKLLKRNAASRLGAGPGDAG
EVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESA
NQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASAS
TANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMN
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctca
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatacgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggcaatgatagtgagaaatgctaaagatacagctcatacaaaagcagaa
cggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttatgcctttcag
actggtggaaaactctacctcatccttgagtatctcagtggaggagaactatttatgcag
ttagaaagagagggaatatttatggaagacactgcctgcttttacttggcagaaatctcc
atggctttggggcatttacatcaaaaggggatcatctacagagacctgaagccggagaat
atcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgcgaactcgtc
attcatgatcaacagtcacatcaccattttgtggaacagatgaatacatgtgagctgcgc
atgttaagcaggattggtttggggcgccccctgaaatctttgatgaaaggtggccacaaa
tcggtgctgctgcgattttgcctcccctacctcacgccaagcaagccagagaatctgctt
aaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcctggggacgctgga
gaagttcaagctcatccattctttagacacattaactgggaagaacttctggctcgaaag
gtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagtcagtttgattcc
aagtttacacgtcagacacctgtcgacagcccagatgactcaactctcagtgaaagtgcc
aatcaggtctttctgggttttacatatgtggctccatctgtacttgaaagtgtgaaagaa
aagttttcctttgaaccaaaaatccgatcacctcgaagatttattggcagcccacgaaca
cctgtcagcccagtcaaattttctcctggggatttctggggaagaggtgcttcggccagc
acagcaaatcctcagacacctgtggaatacccaatggaaacaagtggcatagagcagatg
gatgtgacaatgagtggggaagcatcggcaccacttccaatacgacagccgaactctggg
ccatacaaaaaacaagcttttcccatgatatccaaacggccagagcacttgcgtatgaat
ctatga

DBGET integrated database retrieval system