KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518784
Entry
108518784         CDS       T04641                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05212  Pancreatic cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05340  Primary immunodeficiency
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108518784 (IKBKG)
   04014 Ras signaling pathway
    108518784 (IKBKG)
   04064 NF-kappa B signaling pathway
    108518784 (IKBKG)
   04668 TNF signaling pathway
    108518784 (IKBKG)
   04151 PI3K-Akt signaling pathway
    108518784 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108518784 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108518784 (IKBKG)
   04621 NOD-like receptor signaling pathway
    108518784 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    108518784 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    108518784 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    108518784 (IKBKG)
   04660 T cell receptor signaling pathway
    108518784 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    108518784 (IKBKG)
   04659 Th17 cell differentiation
    108518784 (IKBKG)
   04657 IL-17 signaling pathway
    108518784 (IKBKG)
   04662 B cell receptor signaling pathway
    108518784 (IKBKG)
   04062 Chemokine signaling pathway
    108518784 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108518784 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108518784 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108518784 (IKBKG)
   05203 Viral carcinogenesis
    108518784 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108518784 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108518784 (IKBKG)
   05221 Acute myeloid leukemia
    108518784 (IKBKG)
   05220 Chronic myeloid leukemia
    108518784 (IKBKG)
   05215 Prostate cancer
    108518784 (IKBKG)
   05222 Small cell lung cancer
    108518784 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    108518784 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108518784 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108518784 (IKBKG)
   05135 Yersinia infection
    108518784 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108518784 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    108518784 (IKBKG)
   05161 Hepatitis B
    108518784 (IKBKG)
   05160 Hepatitis C
    108518784 (IKBKG)
   05171 Coronavirus disease - COVID-19
    108518784 (IKBKG)
   05164 Influenza A
    108518784 (IKBKG)
   05162 Measles
    108518784 (IKBKG)
   05168 Herpes simplex virus 1 infection
    108518784 (IKBKG)
   05163 Human cytomegalovirus infection
    108518784 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108518784 (IKBKG)
   05169 Epstein-Barr virus infection
    108518784 (IKBKG)
   05165 Human papillomavirus infection
    108518784 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108518784 (IKBKG)
   05142 Chagas disease
    108518784 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108518784 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108518784 (IKBKG)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108518784 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 108518784
NCBI-ProteinID: XP_017712914
LinkDB
Position
Un
AA seq 285 aa
MAEDKASVKAQVTSLLGELQESQSRLEAATKECQTLEGRARAASEQARQLESEREALQQQ
HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSLVGSER
KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA
ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAY
LSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 858 nt   +upstreamnt  +downstreamnt
atggctgaggacaaggcctctgtgaaagcccaggtgacatccttgctcggggagctgcag
gagagccagagtcgcttggaggctgccactaaggaatgccagactctggagggtcgggcc
cgggcggccagcgagcaggcgcggcagctggagagtgagcgcgaggcactgcagcagcag
cacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtggaggccgcactccgc
atggagcgccaggctgcctcggaggagaagcggaagctggcccagttgcaggtggcctat
caccagctcttccaagaatacgacaaccacatcaagagcagcctggtgggcagcgagcgg
aagcgaggaatgcagctggaagatctcaaacagcagctccagcaggccgaagaggccctg
gtggccaaacaggaggtgatcgataagctgaaggaggaggccgagcagcacaagattgtg
atggagaccgttccggtgctgaaggcccaggcggacatctacaaggcggacttccaggct
gagaggcaggctcgggagaagctggccgagaagaaggagctcttgcaggagcagctggag
cagctgcagagggagtacagcaaactgaaggccagctgtcaggagtcggccaggatcgag
gacatgaggaagcggcatgttgaggtctcccaggcccccttgccccccgcccccgcctac
ctctcctctcccctggccctgcccagccagaggaggagcccccctgaggagccacctgac
ttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcagatacatgtc
atggagtgcattgagtag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535077
Entry
108535077         CDS       T04641                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb05010  Alzheimer disease
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05212  Pancreatic cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108535077 (CHUK)
   04014 Ras signaling pathway
    108535077 (CHUK)
   04064 NF-kappa B signaling pathway
    108535077 (CHUK)
   04668 TNF signaling pathway
    108535077 (CHUK)
   04068 FoxO signaling pathway
    108535077 (CHUK)
   04151 PI3K-Akt signaling pathway
    108535077 (CHUK)
   04150 mTOR signaling pathway
    108535077 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108535077 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108535077 (CHUK)
   04621 NOD-like receptor signaling pathway
    108535077 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    108535077 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    108535077 (CHUK)
   04625 C-type lectin receptor signaling pathway
    108535077 (CHUK)
   04660 T cell receptor signaling pathway
    108535077 (CHUK)
   04658 Th1 and Th2 cell differentiation
    108535077 (CHUK)
   04659 Th17 cell differentiation
    108535077 (CHUK)
   04657 IL-17 signaling pathway
    108535077 (CHUK)
   04662 B cell receptor signaling pathway
    108535077 (CHUK)
   04062 Chemokine signaling pathway
    108535077 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108535077 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108535077 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535077 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108535077 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108535077 (CHUK)
   05221 Acute myeloid leukemia
    108535077 (CHUK)
   05220 Chronic myeloid leukemia
    108535077 (CHUK)
   05215 Prostate cancer
    108535077 (CHUK)
   05222 Small cell lung cancer
    108535077 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108535077 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108535077 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108535077 (CHUK)
   05135 Yersinia infection
    108535077 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108535077 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    108535077 (CHUK)
   05161 Hepatitis B
    108535077 (CHUK)
   05160 Hepatitis C
    108535077 (CHUK)
   05171 Coronavirus disease - COVID-19
    108535077 (CHUK)
   05164 Influenza A
    108535077 (CHUK)
   05162 Measles
    108535077 (CHUK)
   05168 Herpes simplex virus 1 infection
    108535077 (CHUK)
   05163 Human cytomegalovirus infection
    108535077 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108535077 (CHUK)
   05169 Epstein-Barr virus infection
    108535077 (CHUK)
   05165 Human papillomavirus infection
    108535077 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108535077 (CHUK)
   05142 Chagas disease
    108535077 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108535077 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108535077 (CHUK)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     108535077 (CHUK)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108535077 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 108535077
NCBI-ProteinID: XP_017736264
UniProt: A0A2K6LKA1
LinkDB
Position
Un
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLSWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSVWLPPTSAEHDHSLSCVVTPPDGDTSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ttgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaatagagaacgatggtgccac
gaaatccagattatgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgttcct
gaagaactgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctaaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggacgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagctgatgttg
agttgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccgagatgt
tttgtactaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtgtatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggatagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tacagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagtgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggtcggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaacatcaaagaagctgataatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacgtca
gtatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
ccagatggagatacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540719
Entry
108540719         CDS       T04641                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04910  Insulin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108540719 (IKBKB)
   04014 Ras signaling pathway
    108540719 (IKBKB)
   04064 NF-kappa B signaling pathway
    108540719 (IKBKB)
   04668 TNF signaling pathway
    108540719 (IKBKB)
   04068 FoxO signaling pathway
    108540719 (IKBKB)
   04151 PI3K-Akt signaling pathway
    108540719 (IKBKB)
   04150 mTOR signaling pathway
    108540719 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108540719 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108540719 (IKBKB)
   04621 NOD-like receptor signaling pathway
    108540719 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    108540719 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    108540719 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    108540719 (IKBKB)
   04660 T cell receptor signaling pathway
    108540719 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    108540719 (IKBKB)
   04659 Th17 cell differentiation
    108540719 (IKBKB)
   04657 IL-17 signaling pathway
    108540719 (IKBKB)
   04662 B cell receptor signaling pathway
    108540719 (IKBKB)
   04062 Chemokine signaling pathway
    108540719 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108540719 (IKBKB)
   04920 Adipocytokine signaling pathway
    108540719 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108540719 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108540719 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540719 (IKBKB)
   05206 MicroRNAs in cancer
    108540719 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108540719 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108540719 (IKBKB)
   05221 Acute myeloid leukemia
    108540719 (IKBKB)
   05220 Chronic myeloid leukemia
    108540719 (IKBKB)
   05215 Prostate cancer
    108540719 (IKBKB)
   05222 Small cell lung cancer
    108540719 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108540719 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108540719 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108540719 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    108540719 (IKBKB)
   04931 Insulin resistance
    108540719 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108540719 (IKBKB)
   05135 Yersinia infection
    108540719 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540719 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    108540719 (IKBKB)
   05161 Hepatitis B
    108540719 (IKBKB)
   05160 Hepatitis C
    108540719 (IKBKB)
   05171 Coronavirus disease - COVID-19
    108540719 (IKBKB)
   05164 Influenza A
    108540719 (IKBKB)
   05162 Measles
    108540719 (IKBKB)
   05168 Herpes simplex virus 1 infection
    108540719 (IKBKB)
   05163 Human cytomegalovirus infection
    108540719 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108540719 (IKBKB)
   05169 Epstein-Barr virus infection
    108540719 (IKBKB)
   05165 Human papillomavirus infection
    108540719 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108540719 (IKBKB)
   05142 Chagas disease
    108540719 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108540719 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108540719 (IKBKB)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     108540719 (IKBKB)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108540719 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal IKKbetaNEMObind Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 108540719
NCBI-ProteinID: XP_017745365
UniProt: A0A2K6LWA7
LinkDB
Position
Un
AA seq 789 aa
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTVTACVSPLRFHVLSFYSKREKKMETQSGIIPNLSVCLFVYDRVFP
CHPGWSAVA
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacccagacatgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
attgccatcaagcagtgccggcaggagctcagcccccggaaccgagagcggtggtgcctg
gagatccagatcatgagaaggctgacccaccccaatgtggtggctgcccgagatgtccct
gaggggatgcagaacttggcgcccaatgacttgcccctgctggccatggagtattgccaa
ggaggagatctccggaagtacctgaaccagtttgagaattgctgtggtctgcgggaaggt
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcaca
tcattcgtggggaccctgcagtacctggccccagagctgctggagcagcagaagtacacg
gtgactgtcgactactggagctttggcaccctggccttcgagtgcatcacgggcttccgg
cccttcctccccaactggcagcctgtgcagtggcattcgaaagtccggcagaagagtgag
gtggatattgttgtcagcgaagacttgaatggaacagtgaagttttcaagctctttaccc
taccccaataatcttaacagcgtcctggctgagcgactggagaagtggctgcaactgatg
ctgatgtggcacccccgacagaggggcacagatcccacgtatgggcccaatggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacaggc
accatccacacctaccctgtgacagaggacgagagtctgcagagcttgaaggccagaatc
cagcaggacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggca
ttgatccccgataaacctgccactcagtgtatttcggatggcaagttaaatgagggccgc
acattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaggattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccgg
aacaacagctgcctctccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcaa
actgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggcc
gtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctcta
cagacggacatcgtggacttacagaggagccccatgggccggaagcaggggggaacgttg
gacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaagcctcgagac
cagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacacagctcagtaaaactgtggtttgcaagcag
aaggcactggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatt
gcttgtagcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacccgag
ccagccaagaagagtgaagaactggtggccgaagcacataacctgtgtaccctgctagaa
aatgccatacaggacaccgtgagggagcaagaccagagtttcacggtaacagcctgtgtg
agccccctgcgattccatgtcctttcattctatagcaaaagagaaaagaaaatggaaacg
caatctggcattatccccaacctcagtgtttgtttgtttgtttatgacagggtctttccc
tgtcacccaggctggagtgcagtggcatga

DBGET integrated database retrieval system