KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518794
Entry
108518794         CDS       T04641                                 

Gene name
RYR3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04371  Apelin signaling pathway
rbb04713  Circadian entrainment
rbb04921  Oxytocin signaling pathway
rbb04970  Salivary secretion
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108518794 (RYR3)
   04020 Calcium signaling pathway
    108518794 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108518794 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    108518794 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108518794 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108518794 (RYR3)
   05012 Parkinson disease
    108518794 (RYR3)
   05020 Prion disease
    108518794 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    108518794 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108518794 (RYR3)
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Ryanodine receptor
   108518794 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 Ins145_P3_rec SPRY MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 108518794
NCBI-ProteinID: XP_017712922
LinkDB
Position
Un
AA seq 4891 aa
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKLCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLRENATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKADTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHTAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAVWFSKHLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQHSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAVRVFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNTMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLW
SRVPNSFLKVESERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRAGFYDLLISIHLANAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVMTGEEHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAETEEGAEKEEVTQVEEKAVEAGEKASKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLRALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDAELVR
MMFNLLRRQYDSIGELLQALRKTYTISHASVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLSTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVSTEADEEEEEIVH
MGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP
SLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTK
AQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCL
PSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDT
RITATLEKQISVDADGNFDPKPINTVNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKY
GISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGG
GSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGVLVSRGMKDMELDASSMEKRFAYKF
LKKILKYVDSAQEFIAHLEAVVFALNVSALPDSSLQPSSLPHLFCICSPVLQRILCTVSL
QNTVNVSEGLCLISMQLPASVRDIGVGDTKYESFNLCDLLNCFLFCFSLFCKLAALVRHR
ISLFGSDSTTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLG
KFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQHQFGMDLLLGDVQISCYHILCSLY
SLGTGKNIYVERQRPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMP
DMVEDMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLP
PSTGQCCTKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARADLLRSH
FIPTLEKLKKKAVKTVQEEEQLKADGKGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVD
NNRSNWLKSPDADSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSK
MSKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYGH
RDTDEEVREHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVF
HLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIET
EEYSFEEKLVQDLAKSPKVEEEEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTS
YSSMMAKSCQSGEDEEEDEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKG
EMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFE
RQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMG
NTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEY
IQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLL
SLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGII
SKREFQKAMEGQKQYTQSEIDFLLSCADADENDMFNYIDFVDRFHEPAKDIGFNVAVLLT
NLSEHMPNDSRLKCLLGPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKP
QVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDED
SSYVLEIAGEEEEDGSFEPASAFAMACASVKRNVADFLKRATLKNLRKQYRNVKKMTAKE
LVKVLCSFFWMLFLGLFQMLFTILGGIFQVLWSTVFGGGLVEGAKNIRVTKILGDMPDPT
QFGIHDDTMEAERAEVMEPGITTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVG
LGDLSEIIGKDEPPTLESTVQKKRKAQAAEMKAANEAEGKVESEKADMEDGEKEDKDKEE
EQAEYLWTEVTKKKKRRCGQKVEKPEAFTANFFKGLDIYQTKLLHYLARNFYNLRFLALF
VAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRA
LAVIHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLV
INTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVS
WLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTI
LSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFH
MYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQ
QEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQ
ESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
NT seq 14676 nt   +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtgctccagtgcatcgccaccattcacaaggaacagaggaagctctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggagcccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatatggccatgcaattctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaaaatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtcc
gaaggagagaaagttagaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
tacctgcatctctcagtatcaaatggtaacatacaagtggatgcctcctttatgcagaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtacgtcttttccatggtcatgatgagtgtctgacaataccatctacagac
cagaatgactcccagcacaggaggatattctatgaagctgggggagctgggactcgagcc
aggtctctgtggagagtggaaccacttcggataagttggagtggcagcaacatcagatgg
ggccaggcttttcgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactgcaagaccgggcaaaggcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagattccagtcacaagcgagacatagaaggc
atgggagttccagaaatcaagtatggagattctgtctgctttgtacagcatacagccagt
ggtctgtgggtgacctacaaagcacaagatgcaaaaacttcccgcctgggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacaccacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctatagaagaagtcctg
cagaccctccaggacttgatcgcctacttccagcccccggaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcgctcaaaaacagacaaaatcttttcaaggaagaggga
atgttggctcttgtcttaaattgcattgaccgcttaaatatctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgtggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagtccagaagccttaaatctgatagcagagggccac
atcaagtccatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacctgctgccccggagaaacctgctcttgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagtcgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctgacagcagagcctacacatctg
cgggtgggctgggcctcttcctcaggctatgccccatacccaggaggtggagaaggatgg
ggaggcaatggtgttggcgatgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggattcccagagctgtggcttccatcaaccagcacctcctgagatcagatgat
gtggtaagctgctgcctggacctcggcgtgcccagcatttcattccgcatcaatggacaa
cctgtgcaggggatgtttgagaacttcaacacagatgggctcttcttccctgtgatgagc
ttttcagcaggtgttaaagtacgtttcctgatgggtgggcgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggaacctgtcaaagaatataaacgtgatgctgatggtgttagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccatagacaccagtcaggttgtt
ttgccacctcacctcgaaaagatccgagacagactagctgaaaacatccacgagctttgg
ggaatgaataaaatagagcttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctccccgaaactgagaagaattataacctg
caaatgtcgactgaaaccttgaaaaccctcctggccctggggtgtcacattgctcatgtt
aacccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aatggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcgcacaatgtttgggcaaaagacagaataaaa
caagggtggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggacgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacggatataacattgagccatcagaccaagaactagctgac
tcggctgtggagaaagtcagcatagacaagatccgatttttccgggtggagcgatcttat
gccgtgagatctggaaagtggtattttgagtttgaggtggtgactggaggagacatgcga
gttggctgggccaggccaggctgtcggcctgatgttgagctgggggccgatgaccaagcc
tttgtgtttgaaggcagcaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acctggcagccaggagatgtggttggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggctttgtgcccatctgctgtctggggctgtctcagattggccgc
atgaatctcgggacagatgccagtaccttcaagttttataccatgtgtggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctgtgtggttcagcaagcac
ctcccgacgtttgtcaacgtgccaaaggaccatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacccataagacatttggcacacagcat
agcaatgccgacatgatctactgccgcttgagcatgcctgttgagtgccactcttccttc
agccacagcccctgtctggacagtgaagccttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactatgccgtccgcgtctttgctggacaggatcca
tcctgtgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtgcacgaa
agtgtgaaacgcagcaactgctacatggtctggggcggggacatagtggccagttcccag
agatcaaatcggagcaacgtggacctggagatcggctgtcttgtggatctggcaatgggc
atgttgtccttctcagccaacggaaaagaactgggtacctgctaccaggtggagcccaac
accaaagtgttcccagcagtcttcctgcagcctacaagtacttccttgtttcagtttgaa
cttggaaagctgaagaacacaatgcccctgtcggcggccatattcaagagtgaagagaag
aacccggtcccacagtgtccaccgcggctggacgtccaaaccatccagcccgtgctctgg
agccgcgtacccaacagcttcctgaaggtggagagcgagcgcgtgagcgagcgccacggc
tgggtggtgcagtgcctggaacccctgcagatgatggcgctccacatccccgaggagaac
agatgtgtggatatcctggagctctgtgagcaggaggacctgatgaggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgcgtggcctacgccctg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgagctggcttctatgacctgctcatcagcatccacctggccaacgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaatatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgtcatgactggtgaggagcaccaa
aaacagagccctgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcagtgcagtgcagcggggcccacatccgagaccccgtaggggggtctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgac
gacgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagtgcg
gagacagaggagggagcagaaaaggaggaagtgacccaggtggaggagaaggctgtggag
gctggggagaaggccagcaaggaggctcccgtcaaaggcttgttgcagactcgattaccc
gagtccgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtcggcggccctgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgcttcttaacttt
caactgggagagaactgcccctgcccagaggagattcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacaggaaaactccgtgccttggtgtacaaaatcaaaggcccacccaagcca
gagaaggagcagccgacggaggaggaggagagatgccccacaacattgaaggagctcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggatgcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcatcggggagctgctgcaggcgctg
cggaagacgtacaccatcagccatgcctctgtaagcgacaccatcaacctgctggctgcc
ctgggccagatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaacgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgagtacagag
aaatctcagatcgcgtttccaaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttatcttctggag
aatagcagtgttggcctagcctccccgtcgatgaggggatccaccccgctggatgtggca
gcgtcctctgtgatggacaacaatgagttagcgctgggcttggaggaaccagacctggag
aaggtggtgacctacttggcaggctgtggcctgcagagctgccccatgcttctggccaaa
ggataccctgacgtcggctggaaccccatcgaaggggaacgctacctgtccttcctgagg
tttgccgtcttcgtgaacagtgaaagtgtggaagaaaatgccagcgtcgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacggactg
ttggcggccatgcagggtgccattaagatctctgagaaccccgcgcttgacctcccctct
caaggatacaaaagagaagtcagcacggaggccgacgaagaggaagaagaaatcgtgcat
atgggcaatgcaatcatgtcattttattcggcccttatagatctactgggccgctgtgct
cctgaaatgcacctcatccagacaggaaagggggaagccatccgcatcaggtccatactg
cgctccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccc
tcccttaacaaagatgggtcggtcagtgagccagatatggcggccaacttctgccctgac
cacaaggcacctatggtgctgttcttggaccgcgtgtatggcattaaggatcaaactttt
ctgctccacttgctggaagttggatttttacctgacctgagagcttctgcctctctagat
acagtttcgctgagcaccacagaggctgcgcttgcactaaataggtatatatgttctgct
gtgctcccgctcctcacaaggtgtgcccctctctttgccggaacagaacactgcacctct
ctgattgattccacactgcagacgatatacaggctttccaagggacgttccctcaccaaa
gcacaaagggacactatagaagaatgtttgcttgccatttgcaatcacttgaggccttcc
atgttacagcagctcctgcgacgcctcgtttttgatgtgccccaactcaatgaatactgc
aaaatgcctctcaagcttctgacgaatcactatgaacagtgctggaagtattactgcctg
ccttcaggatgggggagctatgggctagctgtggaagaagagctgcacctaacggagaag
cttttctgggggatttttgactctctctcccataagaaatatgacccagatcttttccga
atggccctgccttgtctcagtgctatagctggggccttgccaccggattatttagatacc
agaatcacagccactttggagaaacagatctcagtggatgcagatggcaactttgatccc
aaacctatcaacactgtgaatttttccctgcctgaaaaattggaatacatcgtcaccaag
tatgctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatac
gggatttccctggatgaaaacgtgaagacccacccactgataaggcctttcaagacgtta
acggagaaggagaaggaaatttatcgctggcctgcccgagagtccctgaaaaccatgcta
gctgtgggctggactgtggagaggaccaaagagggagaagccttggttcaacagcgggaa
aatgagaagcttcgaagtgtgtcccaggccaaccagggcaacagctacagccctgctccc
ctcgacctctcaaacgttgtgctctccagagagctccagggaatggtggaggtcgtggct
gagaactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggt
ggcagtcaccctcttctggtaccatatgacaccttgactgccaaggaaaagttcaaggac
cgggagaaggcgcaggacctgtttaagttcctccaagtgaatggcgtcctagtttccagg
ggtatgaaggatatggagctggatgcctcctccatggaaaagaggtttgcctataagttc
ttgaagaagatcctgaaatacgttgattcagcacaagaatttattgcccatttagaagca
gtcgtgtttgcactgaatgtgtctgcattgccagactcctctttgcagccttcgtccttg
ccccacctcttctgcatctgcagccctgtgctccaaaggatactttgcactgtgtctctg
caaaatactgtaaatgtttcagagggattgtgtttaataagcatgcagctgcctgcaagt
gtaagggacatcggggtgggggatacaaagtatgagtcctttaatctctgtgacttgctg
aattgctttcttttctgcttcagcctgttctgcaaacttgctgcccttgttagacacaga
atttccctctttggtagtgattctactacaatggtgagctgtcttcacatcttagctcag
acacttgacacaaggactgtcatgaagtcaggctcagagctggtgaaggctgggttacga
gcattctttgaaaatgctgcagaagacttggagaagacttcagaaaacctgaaacttggg
aagttcacccattcccgaacgcagattaaaggcgtttctcagaatattaactatactaca
gtggctctgctccccatcctgacgtccatctttgagcacgtcgctcagcatcagtttgga
atggatctactcttgggtgatgtgcagatttcctgctaccacatactgtgcagcctctac
tcccttgggacaggaaagaacatttatgttgaaaggcaacgccctgcccttggagaatgt
ctggcctcgctggcagctgccataccagtggcattcctggagcccacccttaatcgctac
aatcctctctcggtcttcaacaccaaaacccccagggagaggtctattctggggatgcca
gacatggtggaagacatgtgtcctgacatcccccagctggaaggcctgatgaaggaaatc
aacgacctggccgagtcaggggcacggtacacagagatgccgcatgtcatcgaggtgatc
ttacccatgctctgcaactacctgtcctactggtgggagagggggcctgagaacctgccc
cccagcacagggcagtgctgcaccaaggtcacctctgaacacctcagtctcatcctgggc
aacattctgaaaatcatcaacaataacctgggcatcgatgaggcctcctggatgaagcgc
attgcagtgtatgcacagcccatcatcagcaaagccagggccgacctgctgagaagccac
ttcatcccaactctggagaagctgaagaaaaaggctgtcaagaccgtgcaggaggaggag
cagttgaaagccgatggcaaaggggacacccaggaggcggagctcctcatcctggatgaa
ttcgcggtcctctgccgagatctctatgccttctaccccatgctgatccgctacgtggac
aacaacagatctaactggctgaaaagccctgatgctgattctgaccagctcttccgcatg
gtggcagaagtcttcatcctgtggtgtaaatctcacaacttcaagagggaagagcaaaat
tttgtgattcagaatgaaattaataatttggcatttttaactggagacagcaaaagcaag
atgtcaaaatctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttg
tattccatccagacctccctcatcgtggctgcactcaagaaaatgctgcctattggtttg
aatatgtgtactccaggcgaccaggagctgatctccctcgcaaaatcacgatacggccat
agggacacagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaag
tctgatgacccagctgtaaaatggcaactgaacctctacaaggatgttctgaagagtgag
gaacctttcaatccagaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttc
cacctggaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaattgcta
tcaaagcaacggaaacgggcagtggtggcctgcttcaggatggctcctctctacaacctg
cccaggcaccgctctattaacctcttcctccatggctatcagagattttggatagaaaca
gaggagtattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaa
gaggaggaggaggaagagacggaaaaacaacctgacccactacatcagatcattctctat
tttagccgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcc
tattccagcatgatggctaagagttgtcaaagtggtgaggacgaagaagaagatgaagac
aaggaaaaaacattcgaagagaaagagatggagaagcagaaaaccctctatcagcaagct
cggctgcatgagcgtggtgccgcagagatggtccttcagatgataagcgccagcaaaggt
gagatgagccccatggtggttgagactctgaagctggggatcgccattctgaacggaggc
aatgctggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattc
tttcaaagcctttctggtcttatgcagtcgtgcagtgtccttgatttgaatgcatttgag
aggcagaataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgt
gaacgtggtgaaaaagtactccagaatgacgagttcacgcgtgatctctttagattccta
cagttactttgtgagggacataacagtgactttcagaacttcctgcggactcagatgggt
aacacgaccaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaa
tcaatcagtgatttctactggtattattcagggaaggacatcattgatgaatccggacag
cacaatttttccaaagctctggcagtcaccaagcagattttcaattctcttacagaatac
atccagggcccttgcattggtaatcagcagagcctggctcacagcaggctgtgggatgcc
gtggttggcttcctccatgtctttgctaatatgcagatgaaactgtctcaggattccagt
cagatcgagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctg
tccctcctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactg
gtagaatcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaactt
aaagacttaaccagctcagacaccttcaaagaatacgacccagatggtaaaggaattatc
tccaaaagagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagatt
gactttctcctttcgtgtgcagacgctgatgagaatgacatgtttaattacattgatttt
gtagaccggttccatgagccggccaaggacatagggtttaatgtggctgtgttattgaca
aatctttctgaacacatgccaaacgattcccgcctgaagtgtctgttgggcccagcagaa
agtgtgctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaag
aaaattgagcgtgtttattttgaaatcagtgagtccagtcgcactcagtgggagaagccc
caggtgaaggaatctaagcgacagttcatttttgatgttgtcaacgaaggtggggagcag
gaaaagatggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagca
tctcagatctctgaatccgattcagcagacaggccagaagaggaggaagaagatgaagat
tcttcttacgtgttagaaattgcgggtgaagaggaggaagacgggtctttcgagccggcc
tctgcatttgcaatggcctgtgcctctgtgaagaggaatgttgccgactttctgaagaga
gcaaccctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggag
ctggtgaaggtgctctgctcctttttctggatgctgttcctggggctattccagatgctc
ttcaccatcctgggaggaatctttcaggtcctctggagcacagtgtttggagggggcctg
gtagaaggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacc
caatttggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggt
atcaccactgaactagtacacttcataaagggggagaagggagatacagatatcatgtca
gacctctttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggt
ttgggtgacctctctgaaattattggcaaggatgaaccccctacgttagagagcactgta
cagaagaagaggaaagctcaggcagcagagatgaaagcagcaaatgaagcagaaggaaaa
gtagaatccgagaaggcagacatggaagatggagagaaggaagacaaagacaaagaagag
gagcaagccgagtacctgtggacagaagtgacaaaaaagaagaagcggcggtgtggtcag
aaggttgagaagccggaagctttcacagccaatttctttaaagggctggacatctatcag
accaagttactgcattacctggccaggaatttctacaacctgaggttcctcgctctgttt
gtagccttcgctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaa
gaagagacagaggatgttgcaaacctatggaattcatttaatgacgaggaagaggaagaa
gcgatggtgttctttgtccttcaggagagcactgggtatatggcaccaacgctgcgggcc
ctggccgtcatccacaccatcatctctctagtctgtgtggtgggctactactgcctgaag
gtgcctttggtggtattcaaaagggaaaaagaaatcgccaggaagctggagttcgatggc
ctatatatcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtg
atcaacacaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatc
aacaagtatggagatctctacggagcagaacgcattgctgaacttctgggtttggacaaa
aatgctcttgacttcagcccagtagaagagaccaaagcagaggcggcttctctggtgtca
tggctaagttccatagacatgaagtaccatatctggaagcttggagttgtttttactgac
aactcctttctctaccttgcctggtatacaaccatgtcagtcctgggccactacaataac
ttcttctttgccgctcacctgctggatatcgcaatgggcttcaagacactgaggaccatt
ctgtcatctgtaactcacaatggcaaacagttggttctgacggtgggtctcctggccgtg
gtggtgtatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagt
gaagacgatgacgagcctgatatgaagtgtgacgacatgatgacgtgttaccttttccac
atgtacgtgggagtgagagcaggaggtggcattggtgacgagattgaagaccctgctggt
gatccttatgaaatgtatcgcattgtctttgacattacctttttcttctttgtcattgtc
atcttgctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccag
caggaacaagtgcgagaagatatggagaccaaatgtttcatctgtgggattggcaatgac
tactttgacacgacccctcatggttttgaaacacatacattacaagagcacaacttagcc
aactacttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcag
gaatcttatgtctggaagatgtaccaagaaaggtgctgggatttcttcccagccggtgac
tgctttcgtaaacagtatgaagatcagcttggataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522194
Entry
108522194         CDS       T04641                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04260  Cardiac muscle contraction
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04371  Apelin signaling pathway
rbb04713  Circadian entrainment
rbb04911  Insulin secretion
rbb04921  Oxytocin signaling pathway
rbb04972  Pancreatic secretion
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108522194 (RYR2)
   04020 Calcium signaling pathway
    108522194 (RYR2)
   04024 cAMP signaling pathway
    108522194 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108522194 (RYR2)
   04921 Oxytocin signaling pathway
    108522194 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108522194 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    108522194 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    108522194 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108522194 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    108522194 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    108522194 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108522194 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108522194 (RYR2)
   05414 Dilated cardiomyopathy
    108522194 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108522194 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:rbb04990]
    108522194 (RYR2)
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Ryanodine receptor
   108522194 (RYR2)
Domain-containing proteins not elsewhere classified [BR:rbb04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   108522194 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RR_TM4-6 RyR SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 108522194
NCBI-ProteinID: XP_017717734
LinkDB
Position
Un
AA seq 4959 aa
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPKLCCECGKAESLEAGRGAGRGHRYRRTLLALGCHVGISDEHAEDKVKKMKLPKN
YQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRN
PRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFR
AEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGN
EHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPACSLGV
AQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIE
VTRIDGTIDSSPCLKVTQKSFGSQNSHTDIMFYRLSMPIECAEVFSKTVAGGLPGAGLFG
PKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFL
LRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSD
FHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGC
VVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAG
LFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMS
LHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAI
ENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKKHGLP
GIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDP
VGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEERDTLEKELS
VDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFS
DDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCP
EEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPVE
SDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTIN
GVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHE
TVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGL
ASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIG
WNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEE
AIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLI
HAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNAVEPDMSAGFCPDHKAAMV
LFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLT
RCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLL
RRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIF
DALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTS
NITIPEKLEYFINKYAEHSHDKWSMDKLANGMFYGEIYSQTLLSSTLMKPYKLYCDKEKR
NFYRCQSKNFKNFMLAWGWRIXKNSGGRQHGLYNRTRRISQTSQVSVDAAHGYSPRAIDM
SNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREK
AQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSR
GKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLF
CKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAEDL
EKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQV
SCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKS
SRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSR
WWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIIN
KVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYA
FYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNM
SFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQEL
IALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDDTSDPEKTV
ERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPL
YNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLI
LLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQ
ARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVG
FFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCE
GHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSK
AIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELL
KELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTS
SDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFH
EPAKDISFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERV
YFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISE
SDLNERSANKEESEKERPEEQGPRMAFFSILTVKSALFALRYNILTLMRMLSLKSLKKQM
KKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGXFRIICSLLLXGSLVEGAKKIKVA
ELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREG
GQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPEKAEGEDGE
KEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALF
VAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYVLEESSGYM
EPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKG
QWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKP
KKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAM
GFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDD
MLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID
AFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINK
DETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14880 nt   +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgatgaagtg
gttctgcagtgcaccgcaaccatccacaaagaacaacagaaactatgcttggcagcagaa
ggatttggcaacagactttgtttcttggagtccacttccaattccaagaatgtaccccca
gacctctccatctgcacctttgtgctggagcagtctctctctgtccgggccctgcaggag
atgctggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctatggacatgccatattg
ctgcgccattcctacagtggcatgtatctgtgctgcctgtccacctcccggtcttcaact
gataagctggcttttgatgttggcttgcaagaggacaccacaggggaggcttgttggtgg
accatacaccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgac
ctcatcttagttagcgtgtcctctgaaaggtacttgcacttgtcttacggcaatggcagc
ttacatgtggatgccgctttccagcagactctctggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgtt
cattatgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacacta
agagttgcgtggagtggaagccacataagatggggccagccattccgactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattggatgta
ggggtgagaaaagaagttgacggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacatgtggacacgggactatggcttacttaccagtctgtggatgtgaaa
tccgtgagaatgggatctatacaacgtaaggctattatgcaccatgaaggccacatggat
gatggcataagtttatcgagatcccagcatgaagaatcacgcacagcacgagttatccgg
agcacagtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcg
aaggcttccaccgtcgatttgcctatagaatccgtaagtctaagtctgcaggatctcatt
ggctactttcacccccccgatgagcatttagaacatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgctcgag
tgcatagaccgattgcatgtctacagcagtgcagcacactttgctgatgttgctgggcga
gaagcaggggaatcttggaaatccattctgaattctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgctcagttttctggctcccttgactggttgatcagc
agattggaaagactggaagcttcttcgggcattctggaagttttacactgtgttttagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatccattatctcactt
ttagacaagcatggaagaaatcacaaggtcctggacgtgttgtgctcactctgtgtttgc
catggggttgcagtccgttctaaccagcatctcatctgtgacaatctcttaccgggaaga
gatttgttattgcagacacgtcttgtgaaccacgtcagcagcatgagacccaatattttt
ctgggcgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaactcacctgcgagtgggctgggcttccact
gaagggtattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagat
gatctcttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagat
ctaagtgccccaagcatctcgttccgaattaatggacaacctgttcaaggcatgtttgag
aatttcaacatcgatggcctcttctttccagtcgttagtttctctgcgggaataaaagta
cgttttctgcttggggggcgacatggagaattcaaatttcttcctccacctgggtacgct
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaaagaacttacacacgtgacctgctgggccccacagtttccctgacacaagct
gccttcacaccgatccctgtggataccagccagattgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggaccgaagctctgctgtgaatgtggaaaagcagagagcctggaggca
ggaagaggggcagggagagggcacaggtaccgcaggactttgttggcattagggtgtcat
gtgggtatatcagatgaacatgctgaagacaaggtgaaaaaaatgaagctacccaagaat
taccagctgacaagtggatacaagcctgcccctatggacctaagctttatcaaactcacc
ccgtctcaagaagcaatggtggacaagttagcagaaaatgcgcacaatgtgtgggcgcgg
gatcgaatccggcagggctggacttacggcatccagcaggacgtaaagaacagaagaaat
cctcgccttgttccctacactcttctggatgaccgaaccaagaaatccaacaaggacagc
ctccgcgaggctgtgcgcacgctgctggggtatggttacaacttggaagcaccagatcaa
gatcatgcagccagagccgaagtgtgcagtggcaccggggaaaggttccgaatcttccgt
gctgagaagacttacgcagtgaaggcgggacggtggtattttgaatttgagacagtcact
gctggagacatgagagttggttggagtcggcctggttgtcaaccggatcaggagcttggc
tcggatgaacgtgcctttgcctttgatggcttcaaggcccagcggtggcatcagggcaac
gaacactatgggcgctcttggcaagcaggcgatgtcgtgggctgtatggttgacatgaac
gaacacactatgatgttcacactgaatggtgaaatccttcttgatgattcaggttcagaa
ctggctttcaaggactttgatgttggcgatggattcatacctgcgtgtagccttggagtg
gctcaagtgggcaggatgaactttggaaaggatgtcagcaccttgaaatacttcaccatc
tgtggcttacaagagggctatgaaccatttgccgttaatacaaatagggatattaccatg
tggctgagcaagaggcttcctcagtttctccaagttccatcaaaccatgaacatatagag
gtgaccagaatagacggcaccatagacagttccccatgtttaaaggtcactcagaagtct
tttggttctcagaacagccacactgatatcatgttctatcgcctgagcatgccgatcgag
tgcgcggaggtcttctccaagactgtggctggagggctccctggggctggcctttttggg
cccaagaatgatttggaagattatgatgctgattctgactttgaggttctgatgaagaca
gctcatggccatctcgtgcccgatcgtgttgacaaagacaaagaagctaccaaaccagag
tttaataaccacaaagattatgcccaggaaaagccctctcgtctgaaacaaagatttttg
cttagaagaacaaagccagattacagcacaagccattctgcaagactcactgaagatgtc
cttgctgatgatcgggatgactatgatttcttgatgcaaacgtccacgtactattactca
gtgagaatctttcctggacaagaacctgctaatgtctgggtgggctggattacatcggat
ttccatcagtatgacacaggctttgacttggacagagttcgcacagtaacagttactcta
ggagatgaaaaaggaaaagtgcatgaaagcatcaaacgcagcaactgctatatggtatgt
gcgggtgagagcatgagccccgggcaaggacgcaacaataatggactggagatcggctgt
gtggtggatgctgccagcgggctgctcacgttcattgccaatggcaaggaactgagcaca
tactatcaggtggagccgagtacaaaattatttcctgcggtttttgcacaagctacaagt
cccaatgttttccagtttgagttgggaagaataaagaatgtgatgcctctctcggcggga
ttattcaagagtgagcacaagaaccccgtgccgcagtgccccccgcgcctccacgtgcag
ttcctgtcacacgtcctgtggagcagaatgcccaaccagtttttgaaggtagatgtgtct
cgaataagtgaacgccaaggctggttggtgcagtgtttggatcctctgcagttcatgtct
cttcatatccctgaggaaaacagatctgttgacatcttagagttgacagagcaggaggag
ttgctgaaatttcactatcacactctgcggctctactcagctgtctgtgctcttgggaac
caccgggtggcccacgccctgtgcagccacgtggatgaacctcagctcctctacgccatt
gagaacaagtacatgcctggtttgctgcgtgctggctactatgacctgctgatcgacatc
cacctgagctcctatgccactgccaggctcatgatgaacaacgagtacattgtccccatg
acggaggagacgaagagcatcaccctgttccctgatgagaacaaaaagcacggccttcca
gggatcggcctcagcacctctctcaggccacggatgcagttttcctcccccagttttgta
agcattagtaatgaatgttaccagtacagtccagagttcccactggacatcctcaaggcc
aagaccatacagatgctgacggaagctgttaaagaaggcagtcttcatgcccgggaccca
gttggagggactactgaattcctctttgtgcctctcatcaagcttttctataccctgcta
atcatgggcatcttccacaacgaggacttgaagcacatcttgcagttgatcgagcccagt
gtgtttaaagaagctgccactccagaggaggagagggatacgctggagaaagagcttagt
gtggatgatgcaaagctgcaaggagctggtgaggaagaagccaaggggggcaagcggccc
aaggaaggcctgctccaaatgaaactgccagagccagttaaattgcagatgtgcctactg
cttcaatacctctgtgactgccaggtccggcaccggatagaagccattgtagccttttca
gatgattttgtagctaagctccaagacaatcaacgtttccggtacaacgaagttatgcaa
gccttaaacatgtcagctgcactcacagccaggaaaacaaaggaatttagatcaccacct
caagaacagatcaatatgcttctcaattttaaggatgacaaaagtgaatgtccatgtcca
gaagaaattcgtgaccaactattggatttccatgaagatttgatgacgcattgtggaatt
gagctggatgaagatgggtctctggatggaaacagtgatttaacaattagagggcgtctg
ctatccctggtagaaaaggtgacatacctgaagaagaagcaagcagaaaaaccagttgag
agtgactccaaaaagtcctccactctgcagcagctgatctctgagaccatggtccgatgg
gctcaggagtctgtcattgaagaccccgagctggtgagggccatgtttgtgttgctccat
cggcagtatgatggcattgggggtcttgttcgggcgctgccaaagacctacacgataaat
ggtgtgtccgtggaggacaccatcaacctgctggcatcccttggtcagattcggtccctg
ctgagtgtgagaatgggcaaagaagaagagaagcttatgattcgtggattaggggatatt
atgaataacaaggtgttttaccagcaccctaatctcatgagggcactggggatgcatgag
actgtgatggaggtcatggtgaacgtccttggaggtggagagtccaaggaaatcaccttt
cccaagatggtggccaactgttgccgttttctctgttacttctgtcgtataagtaggcag
aatcaaaaagctatgtttgatcatctcagttatttactggaaaacagcagtgttggtctt
gcctccccagctatgagaggttcaacaccactggatgtggctgcagcttcggtgatggat
aataatgaactagcattagctctgcgtgagccggatctagaaaaggtagttcgttacttg
gctggttgtggactgcaaagttgccagatgctggtgtctaagggttatccagacattggg
tggaatccagttgaaggagagagatatcttgactttctcagatttgctgtcttctgcaat
ggggagagtgtggaggagaatgcaaatgtcgtggtgagattgctcattcggaggcctgag
tgttttggtcctgctttgagaggagaaggtgggaatgggcttcttgcagcaatggaagaa
gccatcaaaatcgccgaggatccctctcgagatggtccctcaccaaatagcggatccagt
aaaacacttgatacagaggaggaggaagatgacactatccacatggggaacgcaatcatg
accttctatgcagctttgattgacctcttgggacgctgtgcaccagagatgcatttgatt
catgctggtaagggagaagccatcagaattaggtctattttgagatccctaattcccttg
ggagatttggtgggcgttatcagcatcgcttttcagatgccaacaatagccaaagatggg
aatgcggtggagcctgacatgtctgcggggttttgcccagatcacaaggcagccatggtt
ttattccttgacagggtctatggaattgaggttcaagacttcctcctccatcttcttgag
gttggctttctgccagatctccgggcggctgcttctttagatacggcggctttgagtgct
acagacatggccttggccctcaatcggtacctttgcacagccgtcttgccgttgttaaca
agatgtgctcctctctttgctggcacagagcaccatgcttctctcattgactcattactt
catactgtgtatagactttctaagggctgttcacttaccaaagctcagcgggattctata
gaagtttgtttactctctatttgtggacaactgagaccttctatgatgcagcacttactc
agaagattagtatttgatgtcccattattaaatgaacatgcaaagatgcctcttaaactg
ctgacaaatcattatgaaagatgctggaaatattactgcctgcctggagggtggggaaac
tttggtgctgcctcagaagaagaacttcatttgtcaagaaagttgttctggggcattttt
gatgccctgtctcaaaagaaatatgagcaagagcttttcaaactggcactgccttgcctg
agtgcagttgcgggagctttgcctccagactacatggagtcaaattatgtcagtatgatg
gaaaaacagtcatcaatggattctgaagggaactttaacccacaacctgttgatacctca
aatattacaattcctgagaagttggaatacttcattaacaaatatgcagaacactcccat
gacaaatggtcaatggacaagttggcaaatgggatgttttatggggaaatatattcccag
actcttctaagttcaacattaatgaagccatataagctatattgtgacaaagaaaaaaga
aatttttatcgctgccaatcaaagaactttaaaaacttcatgctggcttggggctggaga
atttgaaagaactcgggagggagacagcatggcctttacaaccggactcgtcggatttct
cagacaagccaggtttctgtagatgctgcccatggttacagtccccgggccattgacatg
agcaatgttaccctttctagagacctgcatgctatggcagaaatgatggctgaaaactac
cataatatatgggcaaagaaaaagaaaatggagttggagtccaaaggaggaggtaaccac
cctctgctggtgccctatgatacactgacagccaaagagaaagccaaggatagagaaaaa
gcacaggacatcctcaagttcttgcagatcaatggatatgctgtatctagaggatttaag
gacctggaactggacacgccttctattgagaaacgatttgcctacagtttcctccaacaa
ctaattcgctatgtggatgaagcccatcagtatatcctggagtttgatggtggcagcaga
ggcaaaggagaacatttcccttatgaacaagaaatcaagttctttgcaaaagtcgttctt
cctttaattgatcagtatttcaaaaaccatcgtttatacttcttatctgcagcaagcaga
cctctctgctctggaggacatgcttccaacaaagagaaagaaatggtgactagcctattc
tgcaaacttggagttcttgtcaggcataggatttcactatttggcaacgatgcaacctca
attgtcaactgtcttcatattttgggtcagactttggatgcaaggacagtgatgaagact
ggcctggagagtgttaaaagtgcactcagagcttttctggacaatgccgcagaggatctg
gagaagaccatggaaaacctcaagcagggccagttcactcacacccgaaaccagcccaaa
ggggttactcagattatcaattacaccacagtggccctgcttccaatgctgtcatcatta
tttgaacatattggccagcatcagttcggagaagacctaatactggaagatgtccaggtg
tcttgttatagaattctgactagcttgtatgctttgggaaccagcaagagtatttatgtg
gagaggcaacgttctgcattaggagaatgtcttgctgcctttgctggtgcctttcctgta
gcatttttggaaactcatctggacaaacataatatttactccatctacaataccaagtct
tcacgagaaagagcagcgctcagtttgccaactaacgtggaagacgtttgtccaaatata
ccgtctttggagaaactcatggaagaaatcgtggaattagctgagtccggcattcgctac
actcaaatgccacatgtcatggaagtcatactgcccatgctttgcagctacatgtctcgc
tggtgggagcatggacctgagaacaatccagaacgggccgagatgtgctgcacagccctg
aactcagagcacatgaacacacttctagggaacatattgaaaatcatatataataacttg
gggattgatgagggagcctggatgaagaggctagcagtgttttcccagcctataataaat
aaagtgaaacctcagctcttgaaaactcatttcttgccgttaatggagaaactcaagaaa
aaggcagccatggtggtgtctgaagaagaccacctgaaagccgaggccaggggggacatg
tcagaggctgaactcctcatcctagatgagttcaccacgctggccagagatctctatgcc
ttctaccctctcttgattagatttgtggactataacagggcaaagtggctaaaggagcct
aacccagaagcagaggagctcttccgcatggtggcagaagtgtttatctactggtcgaaa
tcccataatttcaaaagagaagagcagaacttcgttgtacagaatgaaatcaacaatatg
tctttccttattactgataccaagtccaagatgtccaaggcagctgtttctgatcaggaa
aggaagaaaatgaagcgtaaaggagatcggtattccatgcagacctctctgattgtagca
gctctgaagcgcttactgcccattgggttgaacatctgtgccccaggggaccaggagctc
attgctctggccaaaaatcgatttagcctgaaagatactgaggatgaagtacgagatata
atccgcagcaatattcatttacaaggcaagttggaggatcctgctattagatggcaaatg
gctctttacaaagacttaccaaacaggactgacgatacctcagatccagagaagacggta
gaaagagtattggatatagcaaatgtgctttttcatcttgaacagaagtctaaacgtgtg
ggtcggagacattactgtctggtggaacatcctcagagatctaaaaaggctgtatggcat
aaactactctctaagcagaggaaaagggctgttgtagcctgcttccggatggccccttta
tataatctgccaaggcatcgggctgtcaatctctttcttcagggatatgaaaagtcttgg
attgaaacagaagaacattactttgaagacaaactgatagaagatttagcaaaacctggg
gctgaacctccagaagaagatgaaggcactaagagagttgatcctctgcatcagctgatc
cttctgtttagtcggacagctttaacagagaaatgcaaactggaggaagattttttatat
atggcctatgcagatattatggcaaagagttgtcatgatgaggaagatgatgacggtgaa
gaggaagtgaagagttttgaagaaaaagaaatggaaaagcaaaagcttctataccagcaa
gcccgactccacgaccgtggtgcggctgagatggtgctgcagaccatcagtgccagcaaa
ggtgaaactggaccaatggtagcagctactttgaaacttggaattgctattttaaatggt
gggaactccacagtacagcagaaaatgcttgactacctcaaggagaaaaaggatgtgggc
ttctttcagagcctggccggcctgatgcagtcatgtagtgtccttgacctaaatgcattt
gagcgacaaaacaaagctgaaggtcttgggatggtgacagaggaaggatcaggagaaaag
gttctacaggacgatgagttcacctgtgacctcttccgattcctgcagctactctgtgag
ggacacaactcagattttcagaattatctgagaactcagactggcaataatacaactgtc
aacataattatctccactgtagactacctactgagagttcaggaatcaattagtgacttt
tattggtattactctgggaaagatgttattgatgaacaaggacaacggaatttctccaaa
gctattcaagtggcaaaacaagtctttaacactcttactgagtatattcagggtccttgc
actgggaatcaacagagtttggcacacagcaggctgtgggatgctgtagtcggctttctt
catgtatttgcccatatgcagatgaagctgtcgcaggattccagtcaaattgagcttttg
aaagaattaatggatctacagaaggatatggtggtcatgttgctgtccatgctagaaggt
aatgttgttaacggaacgattggcaaacagatggtggatatgcttgtggaatcttccaac
aatgtggagatgattctcaaattttttgacatgttcttaaaactgaaagatttgacgtcg
tctgatacttttaaagaatatgaccctgatggcaagggagtcatttccaagagggacttc
cacaaagcgatggagagtcataagcactacacgcagtcagaaacggagtttcttttgtct
tgtgcggagacagatgagaatgaaacccttgactatgaggagttcgtcaaacgcttccac
gaacctgcaaaggacatcagcttcaatgtcgccgtccttctgacaaacctctctgagcac
atgcccaacgatacccgacttcagactttcctagaattagcagagagtgtcctgaattat
ttccagccctttctgggccgcatcgaaatcatgggaagcgccaaacgcatcgagagggtc
tattttgaaatcagtgagtctagccgaacccagtgggagaagccccaggtcaaggagtcc
aaacgacagttcatatttgatgtggtcaatgaaggaggagaaaaagagaagatggaactc
tttgtgaacttctgtgaggacaccatcttcgaaatgcagctggcggctcagatctcagag
tcggatttgaacgagaggtccgcgaataaggaagaaagtgagaaggagaggccggaagag
cagggcccgagaatggctttcttctccattctgacggtcaagtcggccctgtttgcgctc
aggtacaatatcttgacccttatgcgaatgctcagtctgaagagcctgaagaagcagatg
aaaaaagtcaaaaagatgaccgtgaaggacatggtcacggccttcttttcatcctactgg
agtatttttatgaccctcttgcacttcgtggccagcgttttcagaggcnttttccgcatc
atttgcagcctgctgcttnggggaagcctcgtcgaaggtgctaaaaagatcaaagttgca
gaactcttagccaacatgccagaccccactcaggatgaggttagaggagatggggaggag
ggagagaggaaacccctggaagccgccctgccctctgaggatctgaccgacttaaaggag
ctgacagaagaaagtgaccttctttcagacatctttggcctggatctgaagagagaagga
ggacagtacaaactaatccctcataatccaaatgctggactcagtgacctcatgagcaac
ccagtccccatgcctgaggtgcaagaaaaatttcaggaacagaaggcaaaagaagaagaa
aaggaagaaaaagaagaaaccaaatctgaacctgaaaaagccgagggagaagatggagaa
aaagaagagaaagccaaggaagacaagggcaaacaaaagttgaggcagcttcacacacac
agatacggagaaccagaagtgcccgagtcagcgttctggaagaaaatcatagcataccaa
cagaaacttctaaactattttgctcgcaacttttacaacatgagaatgttagccttattt
gtcgcatttgctatcaatttcatcttgctcttttataaggtctccacttcttctgtggtt
gaaggaaaggagctccccactagaagttcaagtgaaaatgccaaagtgaccagcctggac
agcagctcccacagaatcatcgcagttcactatgtactggaggagagcagcggctacatg
gagcccactttgcgtatcttagctattctccacacagtcatttctttcttctgcatcatt
ggatactactgcttgaaagtcccattggttatttttaagcgagaaaaggaagtagcacgg
aaattggaatttgatgggctttatattacagaacagccttcagaagatgatattaaaggc
cagtgggatagactcgtaatcaacacacagtcatttcccaacaactactgggacaaattt
gttaaaagaaaggtaatggataagtacggagagttctacggccgagacagaattagtgaa
ttacttggcatggacaaggcagctctggacttcagtgatgccagagaaaagaagaagcca
aagaaagacagctccttatcagctgtactgaactctattgatgtgaagtatcagatgtgg
aaactaggagtcgttttcactgacaactccttcctctacctagcctggtatatgactatg
tctgttcttggacactataacaactttttttttgctgctcaccttctcgacattgctatg
ggattcaagacattaagaaccatcttgtcctcagtaactcacaatggcaaacagctcgta
ttaaccgttggcttgttagctgttgttgtatacctgtacactgtggtggcattcaatttt
ttccgaaaattctacaataaaagtgaagatggtgatacaccagatatgaaatgtgatgat
atgctaacatgctatatgttccacatgtatgttggagttcgtgctggaggagggatcggg
gatgaaatcgaagacccagcaggagatgaatatgagatctatcgaatcatctttgacatc
actttcttcttctttgttattgtcattctcttggccataatacaaggtctaattatcgat
gcttttggagaactaagagaccaacaggaacaagtcaaagaagacatggagaccaaatgc
ttcatctgtgggataggcaatgattacttcgacacagtgccacatggctttgaaacccac
actttacaggagcacaacttggctaattacttgttttttctgatgtatcttataaacaaa
gatgaaacagaacacacaggacaggaatcttatgtctggaagatgtatcaagaaaggtgt
tgggaatttttcccagcaggggattgtttccggaaacagtatgaagaccagctaaattga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538989
Entry
108538989         CDS       T04641                                 

Gene name
RYR1
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  ryanodine receptor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04371  Apelin signaling pathway
rbb04713  Circadian entrainment
rbb04730  Long-term depression
rbb04921  Oxytocin signaling pathway
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108538989 (RYR1)
   04020 Calcium signaling pathway
    108538989 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108538989 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    108538989 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108538989 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108538989 (RYR1)
   05020 Prion disease
    108538989 (RYR1)
   05022 Pathways of neurodegeneration - multiple diseases
    108538989 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108538989 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108538989 (RYR1)
   04040 Ion channels [BR:rbb04040]
    108538989 (RYR1)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108538989 (RYR1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108538989 (RYR1)
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Ryanodine receptor
   108538989 (RYR1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 CDC45
Other DBs
NCBI-GeneID: 108538989
NCBI-ProteinID: XP_017742838
LinkDB
Position
Un
AA seq 4985 aa
MGDAEGEDDVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDAIGEACWWTTHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDMAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLIGYGYNIEPPDQEPSQVENQSRWDRVRIFRAEKSY
AVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVARVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWGEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWVGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNIHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSECKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCREPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVSTSLRPPHHFSAPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKMIEPEVFTEEEEEEEEEEEEEEEEDEEEKEEDEEETAQEKEDEEKEEEEAAEGEKE
EGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGL
LMKAFSMTAAETARRTREFRSPPQEQINMLLQFKDSTDEEDCPLPEEIRQDLLDFHQDLL
AHCGIQLDGEEEEPEEETTLGSRLMSLLEKVRLVKKKEDNPEEERPAEENKPRSLQELVS
HMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQACKGEALRIRAILRS
LVPLEDLVGIISLPLQMPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMV
DSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKM
PLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMA
MPCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFA
EYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAW
EWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLA
ENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTR
GLKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFA
KILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGT
DAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQAR
TQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTK
NIYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEM
CPDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAG
APPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFI
PTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNN
RAQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMA
KSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKD
TDEEVREFLNNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLY
HLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILT
EDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKRCPDHIPSLTS
PQTGRGSVAMAYARSLAKAGLESLDLPPWVCLPAQEKEMEKQRLLYQQARLHTRGAAEMV
LQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTC
SVLDLNAFERQNKAEGLGMVNEDGTGEALSWASLSLGHLLSGFPPPTLFISPDFQNYLRT
QTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSL
TEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVV
MLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPR
GLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAV
LLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQW
EMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEG
AAEAAVEGAEESAAGTEGMAATAAAGATARVAAAMAGAAAAGALGLLWGSLFGGGLVEGA
KKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGAGEGAGDAAEGAGDEEEAVDEAGP
GGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEP
EPEPELEPEKADAENGEKEEVPEPPPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFL
NYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGGSGWG
LGAGEEAEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFK
REKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIY
GRERIAELLGMDLATLEITAHNERKPNPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYL
GWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYT
VVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELY
RVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTP
HGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQY
EDQLS
NT seq 14958 nt   +upstreamnt  +downstreamnt
atgggtgacgcagaaggggaggacgacgtccagttcctgcggacggatgatgaggtggtc
ctgcagtgcagcgccacagtgctcaaggagcagctcaagctctgcctggccgccgagggt
ttcggtaaccgcctgtgcttcctggagcccaccagcaacgcccagaatgtgccccctgat
ctggccatctgttgcttcgtcctggagcagtccctgtccgtgcgagccctgcaggagatg
ctggccaacacggtggaggccggcgtggagtcatcccagggcgggggacacaggacgctc
ctgtatggccatgccatcttactccggcacgcacacagccgcatgtatctgagctgcctc
accacctcccgctccatgactgacaagctggccttcgatgtgggactgcaggaggacgca
ataggagaggcttgctggtggaccacgcacccagcctccaagcagaggtctgaaggagaa
aaggtccgtgttggggatgacatcatccttgtcagtgtctcctccgaacgctacctgcac
ctgtcgactgccagcggggagctccaggttgatgcttccttcatgcagacactgtggaac
atgaaccccatctgctcccgctgcgaagagggcttcgtgacaggaggtcacgtcctccgc
ctctttcatggacatatggatgagtgtctgaccatttcccctgctgacagtgacgaccag
cgcagacttgtctactatgaggggggagctgtgtgcacccacgcccgctccctctggagg
ctggagccactgagaatcagctggagtgggagccacctacgctggggccagccactccga
gtccggcatgtcaccaccgggcggtacctggcactcaccgaggaccagggcctggtggtg
gttgacgccagcaaggcccataccaaggctacgtccttctgcttccgcatctccaaggag
aagctggatatggcccccaagcgggatgtggaaggcatgggcccccctgagatcaagtac
ggggagtcactgtgctttgtgcagcatgtggcctcaggactgtggctcacctatgccgct
ccagaccccaaggccctgaggctcggcgtgctcaagaagaaggccatgctgcatcaggaa
ggccacatggacgacgccctgtcactgacccgctgccagcaggaggagtcccaggctgcc
cgcatgatccacagcaccaatggcctgtacaaccagttcatcaagagcctggacagcttc
agcgggaagccacggggctcggggccgccggctggcacggcgctgcccatagagggcgtt
atcctgagcctgcaggacctcatcatttacttcgagccgccctccgaggacttgcagcat
gaggagaagcagagcaagctgcgaagcctgcgcaaccgccagagtctcttccaggaggag
gggatgctctccctggtcctgaattgcattgaccgcctaaatgtctacaccactgctgcc
cactttgccgagtttgcaggggaggaggcagctgagtcctggaaagagattgtgaatctt
ctctatgaactcctggcttctctgatccgtggtaatcgtagcaactgtgccctcttctcc
acaaacttggactggctggtcagcaagctggatcggctggaggcctcatctggcatcctg
gaggtcctgtactgtgtcctcattgagagtccagaggttctgaacatcatccaggagaat
cacatcaagtccatcatctccctcctggacaagcatgggaggaaccacaaggtcctggac
gtgctatgctccctgtgtgtgtgtaatggtgtggctgtacgctccaaccaagatcttatt
actgagaacttgctgcctggccgggagcttctgctgcagacaaacctcatcaactatgtc
accagcatccggcccaacatcttcgtgggccgagcagagggcaccacgcagtacagcaaa
tggtactttgaggtgatggtggacgaggtgactccatttctgacagctcaggccacccac
ttgcgggtgggctgggccctcactgagggctacagcccctaccctgggggcggcgagggc
tggggcggcaacggggtcggcgatgacctctattcctacggctttgatggactgcatctc
tggacaggacacgtggcacgcccagtgacttccccagggcagcacctcctggcccctgaa
gacgtagtcagctgctgtctggacctcagcgtgccgtccatctccttccgcatcaatggc
tgccctgtgcagggcgtctttgagtccttcaacctggacgggcttttcttccctgttgtc
agcttctcggctggtgtcaaggtgcggttcctccttggtggccgccatggtgaattcaag
ttcctgcccccacctggctatgccccatgccatgaggctgtgctccctcgagagcgactc
catcttgaacccatcaaggagtatcgacgggaggggccccgggggcctcacctggtgggc
cccagtcgctgcctctcacacaccgactttgtgccctgccctgtggacaccgttcagatc
gtcctaccaccccatctggagcgcattcgggagaagctggcggagaacatccacgagctc
tgggcactgacccgcattgagcaaggctggacctacggcccggttcgggatgacaacaag
aggctgcacccatgtcttgtggacttccatagccttccagagcccgagaggaactacaac
ctgcagatgtcaggggagacgctcaagactctgctggctctgggctgccacgtgggtatg
gcggacgagaaggcagaggacaacctgaagaagacaaaactccccaagacgtatatgatg
agcaatgggtacaagccggctccgctggacctgagccacgtgcggctgacgccggcgcag
acaacactggtggaccgtctggcagaaaatgggcacaacgtgtgggcccgagaccgtgtg
ggccagggctggagctacagtgcggtgcaggacatccctgcgcgccgaaacccacggctt
gtgccctaccgcctgctggacgaggccaccaagcgcagcaaccgggacagcctctgccag
gccgtgcgcaccctcataggttacggctacaacatcgagcctcctgaccaggagcccagt
caggtggagaatcagtctcgttgggaccgggtgcgcatcttccgggcagagaaatcctat
gcagtgcagagcggccgctggtacttcgagtttgaagcagtcaccacaggcgagatgcga
gtgggctgggcgaggcccgagctgaggcctgatgtagagctgggagctgatgagctggcc
tatgtcttcaatgggcaccgcggccagcgctggcacttgggtagtgaaccatttgggcgc
ccctggcagccgggcgatgtagttggctgtatgatcgacctcacagagaacaccattatc
ttcaccctcaatggcgaggtcctcatgtctgactcgggctcagaaacagccttccgggag
attgagattggggacggcttcctgcccgtctgcagcttgggacctggccaggtgggtcac
ctgaacctgggccaggacgtgagctccctgcgattctttgccatctgcggcctccaggaa
ggcttcgagccatttgccatcaacatgcagcgcccagtcaccacctggttcagcaaaagc
ctgccccagtttgagccagtgccccttgaacaccctcactacgaggtagcccgagtggac
ggcactgtggacacgcctccctgtctgcgtctgacccaccgcacctggggctcccagaac
agcctggtggagatgctcttcctgcggctgagcctcccagtccagttccaccagcacttc
cgctgcaccgcaggggccaccccgctggcaccccccggcctgcagccccccgccgaggat
gaggcccgggcggcggaacccgaccctgactacgaaaacctgcgccgctcagctgggggc
tggggcgaggccgagaacggcaaagaagggactgcgaaggagggcgcccccgggggcacc
ccgcaggcggggggagaggcgcagcccgccagggctgagaatgagaaggacgccaccacc
gagaagaacaagaagagaggcttcttattcaaggccaagaaggtcgccatgatgacccaa
ccaccggccacccccacgctgcctcggctccctcacgatgtggtgcctgcagacaaccgc
gatgaccctgagatcatcctcaacaccaccacgtactattactccgtgagagtctttgcc
ggacaggagcccagctgtgtgtgggtgggctgggtcactcctgactaccatcagcatgac
atgagcttcgacctcagcaaggtccgggtcgtgacggtgaccatgggggatgaacaaggc
aacatccacagcagcctcaagtgcagcaattgctacatggtgtggggtggggactttgtg
agtcccgggcagcagggccggatcagccacacggatcttgtcattgggtgcctggtggac
ttggctactggcttaatgacctttacagccaatggcaaagagagcaacacctttttccag
gtggaacccaacacaaagctatttcctgctgtcttcgtcctgcccacccaccagaacgtc
atccagtttgagctggggaagcagaagaacatcatgccgttgtcagccgccatgttccag
agcgagtgcaagaacccggccccgcagtgcccgccgcggctggagatgcagatgttgatg
ccagtgtcctggagccgcatgcccaaccacttcctgcaggtggagacgaggcgcgccggc
gagcggctgggctgggccgtgcagtgccgggagccgctgaccatgatggcgctgcacatc
cccgaggagaaccgatgcatggacatcctggagttgtccgagcgcctggacctccagcgc
ttccactcgcacaccctgcgcctctaccgcgctgtgtgcgccctgggcaacaatcgcgtg
gcgcacgctctgtgcagccacgtcgaccaggctcagctgctgcacgccctggaggacgcg
cacctgccaggcccactgcgtgcaggctactacgacctcctcattagcatccacctcgaa
agtgcctgccgcagccgccgttccatgctctctgaatacatcgtacccctcacgcctgag
actcgcgccatcacgcttttccctcctggaagaagcacagaaaatggtcacccccggcac
ggcctaccgggagttggagtcagcacttcgctgcggcccccgcatcatttctcggccccc
tgtttcgtggcggctctgccagctgctggggcagcagaggctccggcccgcctcagcccc
gccatcccgctggaggctctacgggacaaggcactgaggatgctgggggaggcggtgcgc
gatggtgggcagcacgctcgcgaccccgtcgggggctccgtggagttccagtttgtgcct
gtgctcaagctcgtgtccaccctgctggtgatgggcatctttggtgatgaggatgtgaaa
cagatcttgaagatgattgagcctgaagtcttcactgaggaagaagaggaagaggaggag
gaggaagaagaggaggaagaggaagatgaggaggagaaggaggaggatgaggaggaaaca
gcacaggaaaaggaggatgaagaaaaagaggaagaggaggcagcagaaggggagaaggaa
gaaggcttggaggaggggctgctccagatgaagttgccagagtctgtgaagttacagatg
tgccacctgctggaatatttctgtgaccaagagttgcagcaccgtgtggagtccctggca
gcctttgcggagcgctatgtggacaagctccaggccaaccagcggagccgctatggcctc
ctcatgaaagccttcagcatgactgcagcggagactgcaagacgtacccgcgagttccgc
tccccgccccaggagcagatcaatatgctattgcaattcaaagatagtacagatgaggaa
gactgtccactccctgaagagatacgacaggatttgcttgactttcatcaagacctactg
gcacactgtggaattcagctggatggagaggaggaggaaccagaggaagagaccaccctg
ggcagccgcctcatgagccttttggagaaagtgcggctagtgaagaagaaggaggacaac
cctgaggaggagcggccagcagaggagaacaaaccccggtccctgcaggaactggtgtcc
cacatggtggtgcgctgggcccaagaggacttcgtgcagagccccgagctggtgcgggcc
atgttcagcctcctgcaccggcagtacgacgggctgggtgagctgctgcgtgccctgcca
cgggcgtacaccatctcaccgtcctccgtggaagacaccatgagcctgcttgagtgcctc
ggccagatccgctccctgctcatcgtgcagatgggccctcaggaggagaacctcatgatc
cagagcatcgggaacatcatgaacaacaaagtcttctaccaacacccgaacctgatgagg
gcgctgggcatgcacgagacagtcatggaggtcatggtcaacgtccttgggggcggcgag
tccaaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgttatttc
tgccgcatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggag
aacagcggcatcggcctgggcatgcagggctccacgcccctggacgtggctgctgcctcc
gtcattgacaacaatgagctggccttggcgttgcaggagcaggacctggaaaaggtcgtg
tcctacctggcaggctgtggcctccaaagctgccccatgcttgtggccaagggataccca
gatattggctggaacccctgcggtggagagcgctacctggacttcctgcgcttcgctgtc
ttcgtcaacggcgagagcgtggaggagaacgccaacgtggtggtgcggctgctcatccgg
aagcctgagtgctttggacccgccctgcggggtgagggtggctcagggctgctggctgcc
atcgaagaggccatccgcatctccgaggaccctgcgagggatggcccaggcatccgcagg
gaccggcggcgcgagcacttcggtgaggaaccacctgaagaaaaccgggtgcacctggga
cacgccatcatgtccttctatgccgccttgatcgacctgctcggacgctgtgcgccagag
atgcatctaatccaagcctgcaagggtgaggccctgcggatccgtgccatcctccgctcc
cttgtgcccttggaggaccttgtgggcatcatcagcctcccactgcagatgcccaccctg
ggcaaagacggggctctggtgcagccaaagatgtcagcatccttcgtgccggaccacaag
gcgtccatggtgctcttcctggaccgtgtgtacggcattgagaaccaggacttcttgctg
cacgtgctggacgtgggattcctgcccgacatgagggcagccgcctcactggacacggcc
actttcagcaccaccgagatggcgctggcgctgaaccgctacctgtgcctggctgtgctg
cctctcatcaccaagtgtgcgccgctctttgcgggcacggaacaccgcgccatcatggtg
gactccatgctgcacacggtgtaccgcctgtcccggggtcgttcgctcaccaaggcgcag
cgcgacgtcatcgaggactgcctcatggctctctgcaggtacatccgcccgtcgatgctg
cagcacctgctgcggcgtctggtgttcgacgtgcccatcttaaatgagttcgccaagatg
ccactgaagctcctcaccaaccactatgagcgttgttggaagtactactgcctacccaca
ggctgggccaacttcggggtcacctcggaggaggagctgcacctcacgcggaaactcttc
tggggcatctttgactctctggcccataagaaatacgacccggagctttaccgaatggcc
atgccttgtctgtgtgccatcgctggggctctgccccctgactacgtggacgcctcatac
tcatctaaggcggagaaaaaggccacagtggatgctgaaggcaactttgatcctcggcct
gtggaaaccctcaatgtgatcatcccggagaagctggactccttcattaacaagtttgcg
gagtatacacatgagaagtgggcctttgacaagatccagaacaactggtcctatggagag
aacatagatgaggagttgaagacccaccccatgctgaggccctacaagaccttttcagag
aaggacaaagagatttaccgctggcccatcaaggagtccctgaaggccatgattgcctgg
gaatggaccatagagaaggccagggagggtgaggaggagaagacggaaaagaaaaaaacg
cggaagatatcacaaagtgcccagacctacgatcctcgagaaggctacaacccccagccc
cccgaccttagcgcagttaccctgtcccgggagctgcaggccatggcagaacaactggcg
gaaaattaccacaacacgtggggaaggaagaagaagcaggagctggaagccaaaggcggt
gggacccaccccctgctggtcccctacgatacgctaacggccaaggagaaggcacgagat
cgagagaaggcccaggagctgctgaaattcctgcagatgaatggctacgcggttacaaga
ggccttaaggacatggaactggactcgtcttccattgaaaagcggtttgcctttggcttc
ctgcagcagctgctgcgctggatggacatttctcaggagttcattgcccacctggaggct
gtggtcagcagcgggcgagtggaaaagtccccacatgaacaggagattaaattctttgcc
aagatcctgctccctttgatcaaccagtacttcaccaaccactgcctctatttcctgtcc
actccggctaaagtgctgggcagtggtggccacgcctccaacaaggagaaggaaatgatc
accagcctcttctgcaaacttgctgctcttgtccgccaccgagtctctctctttgggacg
gacgccccggctgtggttaactgtcttcacatcctggcccgctccctggatgccaggaca
gtgatgaagtcaggccctgagatcgtgaaggctggcctccgctccttcttcgagagtgcc
tcggaggacatcgagaagatggtggagaacctgcgactgggcaaggtgtcacaggcgcgc
acccaggtgaagggcgtgggccagaacctcacctacaccaccgtggcgctgctgccggtc
ctcaccaccctcttccagcacatcgcccagcaccagttcggagatgacgtcatcctggac
gacgtccaggtctcttgctaccgaacgctgtgcagtatctactccctgggaaccaccaag
aacatttacgtggaaaagcttcggccagccctcggggagtgcctggcccgtctggcagca
gccatgccggtggcgttcctagagccgcagctgaatgagtacaacgcctgctctgtgtac
accaccaagtctccccgagagcgggccatcctggggctccccaacagtgtggaggagatg
tgtcctgacatcccggtgctggagcggctcatggcagacatcggggggctggccgagtca
ggggcccgctacacagagatgccgcacgtcattgagatcacgctgcccatgctatgcagc
tacctgccccgatggtgggagcgcgggcctgaggcaccccctcctgccctgcccgccggc
gcccccccaccctgcacagctgtcacctctgaccacctcaactccctgctggggaatatc
ctgagaatcatcgtcaacaacctgggcattgacgaggcctcctggatgaagcggctggct
gtgttcgcacagcccatcgtgagccgcgcgcggccggagctcctgcagtcccacttcatc
cccaccatcgggcggctgcgcaagagggcagggaaggtggtgtccgaggaggagcagctg
cggctggaggccaaggccgaggcccaggagggcgagctgctggtgcgagatgagttctct
gtgctctgccgggacctgtacgccctgtatccgctgctcatccgctatgtggacaacaac
agggcgcagtggctgacggagccaaatcccagcgcagaggagctgttcaggatggtgggc
gagatcttcatctactggtccaagtcccacaacttcaagcgcgaggagcagaactttgtg
gtccagaacgagatcaacaacatgtccttcctgactgcggacaacaagagcaaaatggct
aagtccggtggctcggaccaggaacgcaccaagaagaagcgccgcggggaccggtactct
gtgcagacgtcgctgatcgtggccacgctgaagaagatgctgcccatcggcctgaacatg
tgcgcgcccactgaccaggacctcatcacgctggccaagacccgctatgccctgaaagac
acagatgaggaggtccgggaatttctgaacaacaaccttcaccttcagggaaaggtcgaa
ggctccccgtctctgcgctggcagatggccctgtaccggggcgtcccgggtcgtgaggag
gacgctgacgaccccgagaaaatcgtgcgcagagtccaggaagtgtcagccgtgctctac
cacctggaccagaccgagcacccttacaagtctaagaaggctgtgtggcacaagcttttg
tccaagcagcgccggcgggcagttgtggcctgtttccgtatgacgcccctgtacaacctg
cccacgcaccgggcatgtaacatgttcctggagagctacaaggctgcatggatcctgact
gaagaccacagttttgaggaccgcatgatagatgacctttcaaaagctggggagcaggag
gaggaggaggaagaggtggaagaaaagaagccagaccccctgcaccagttggtcctgcac
ttcagccgcactgccctgacggaaaagaggtgtcctgaccacatcccttcgcttacttcc
ccacaaactgggcgaggttctgtagccatggcctatgcccgatctctggcaaaggctggg
ctggaaagcctggacttgcccccatgggtctgcctccctgcccaggagaaagagatggag
aagcagcggctcctataccagcaagcacgactgcacacccggggggcagccgagatggtg
ctgcagatgatcagtgcctgcaaaggagagactggtgccatggtgtcctccaccctgaag
ctgggcatctccatcctcaatggaggcaatgctgaggtccagcagaaaatgctggattat
cttaaggacaagaaggaagttggcttcttccagagtatccaggcactgatgcaaacatgc
agcgtactggatctcaatgcctttgagagacagaacaaggccgaggggctgggcatggtg
aacgaggatggcactggtgaggccctctcttgggcttccctctccctgggacatcttctt
tcgggattcccgccacccacccttttcatctcaccagatttccagaactacctacggaca
cagacagggaacacgaccactattaacatcatcatctgcacggtggactacctcctgcgg
ctgcaggaatccatcagcgacttctactggtactactccggcaaggatgtcattgaagag
cagggcaagaggaacttctccaaagccatgtcggtggctaagcaggtgttcaacagcctc
actgagtacatccagggcccctgcaccgggaaccagcagagcctggcccacagccgccta
tgggacgcagtggtgggattcctgcacgtgttcgcccacatgatgatgaagctcgctcag
gactcaagccagatcgagctgctgaaggagctgctggatctgcagaaagacatggtggtg
atgctgctgtcgttactagaagggaacgtggtaaacggcacgatcgcccggcagatggtg
gacatgctcgtggaatcctcttccaatgtggagatgatcctcaagttcttcgacatgttc
ctgaaactcaaggacattgtgggctctgaagccttccaggactacgtaacggatccccgt
ggcctcatctccaagaaggacttccagaaggcaatggacagccagaagcagttcagtggt
ccagaaatccagttcctgctttcgtgctccgaagcggatgagaacgagatgatcaactgc
gaggagttcgccaaccgcttccaggagccagctcgcgacatcggcttcaacgtggcggtg
ctgctgaccaacctgtcagagcatgtgccgcatgacccgcgcctgcacaacttcctggag
ctggccgagagcatcctcgagtacttccgcccctacctgggccgcatcgagatcatgggc
gcctcgcgccgcatcgagcgcatctacttcgagatctcggagaccaaccgcgcccagtgg
gagatgccccaggtgaaggagtccaagcgccagttcatcttcgacgtggtgaacgagggc
ggcgaggccgagaagatggaactcttcgtgagtttctgcgaggacaccatcttcgagatg
cagatcgccgcgcagatctcggagcccgaaggcgagccggagaccgacgaggacgagggc
gcagcggaggcggccgtggagggcgcggaggagagcgcggcggggaccgagggcatggcg
gccacggcggcggcaggggcgacagcgcgggtggcggcggccatggctggcgcggcggcg
gcgggcgcgctgggcctgctctggggttcgctgttcggcggcggcctggtggagggcgcc
aaaaaggtgacggtgaccgagctcctggcaggcatgcccgaccccaccagcgacgaggtg
catggcgagcagccggccgggcccggcggagacgcagacggcgagggtgccggcgagggc
gcaggagacgccgcggagggcgctggagacgaggaggaggcggtggacgaggccgggccg
ggcggcgccgacggggcggtagccgtgacggatgggggccccttccggcccgaaggggct
ggcggtctcggggacatgggagacacgacgcctgcggaaccgcccacgcccgagggctct
cccatcctcaagaggaagctgggggtggatggagtggaggaggagctcccgccagagccg
gagccggaaccagaactggagccggagaaagccgatgccgagaatggggagaaagaagaa
gttcccgaacccccaccagagccccccaagaagcaagcacctccctcaccccctccaaag
aaggaggaagctgggggcgaattctggggagaactggaggtgcagagggtgaagttcctg
aactacctgtcccggaacttttacaccctgcgcttccttgccctcttcttggcatttgcc
atcaacttcatcttgctgttttataaggtctcagactctccaccaggggaagacgacatg
gaaggctcagctgctggggacgtgtcaggtgcaggctctggtggcggctccggctggggc
ttgggggccggagaggaggcagagggcgatgaggatgagaacatggtgtactacttcctg
gaggagagcacaggctacatggagcccgccctgcggtgtctgagcctcctgcatacactg
gtggcctttctctgcatcattggctataactgtctcaaggtgcccctggtaatctttaag
cgggagaaggagctggcccggaagctggagtttgacggcctatacatcacagagcagcct
gaggacgatgacgtgaaggggcagtgggaccgactggtgctcaacacaccgtctttcccc
agcaactactgggacaagtttgtcaagcgcaaggtcctggacaaacatggggacatctat
gggcgggagcggattgctgagctactgggcatggacctggccacactagagatcaccgcc
cacaatgagcgcaagcccaacccgccaccagggctgctgacgtggctcatgtccatcgat
gtcaagtaccagatctggaagttcggggtcatcttcacagacaattccttcctgtacctg
ggctggtatatggtgatgtccctcttggggcactacaacaacttcttcttcgctgcccat
ctcctggacatcgccatgggggtcaagacactgcgcaccatcctctcctccgtcacccac
aatgggaaacagctggtgatgaccgtgggccttctggcagtggtcgtctacctgtacacc
gtagtggccttcaacttcttccgcaagttctacaacaagagcgaggatgaagatgagcct
gacatgaaatgtgacgacatgatgacgtgttacctgtttcacatgtacgtgggtgtccgg
gctggcggaggcattggggacgagattgaggaccccgcgggtgatgaatacgagctctac
agggtggtcttcgacatcaccttcttcttcttcgtcatcgtcatcctgttggccatcatc
cagggtctgatcatcgacgcttttggtgagcttcgagaccaacaagagcaagtgaaggag
gatatggagaccaagtgcttcatctgtggaattggcagcgactactttgataccacaccg
catggcttcgagactcacacgctggaggagcacaacctggccaattacatgtttttcctg
atgtatttgataaacaaggatgagacagaacacacaggtcaggagtcttatgtctggaag
atgtaccaagagagatgttgggatttcttcccggctggcgattgtttccgcaagcagtat
gaggaccagcttagctga

DBGET integrated database retrieval system