KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518939
Entry
108518939         CDS       T04641                                 

Gene name
SERPINE1
Definition
(RefSeq) serpin family E member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04115  p53 signaling pathway
rbb04218  Cellular senescence
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04610  Complement and coagulation cascades
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108518939 (SERPINE1)
   04371 Apelin signaling pathway
    108518939 (SERPINE1)
   04066 HIF-1 signaling pathway
    108518939 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108518939 (SERPINE1)
   04218 Cellular senescence
    108518939 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    108518939 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108518939 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108518939 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108518939 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108518939 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108518939 (SERPINE1)
Peptidases and inhibitors [BR:rbb01002]
 Peptidase inhibitors
  Family I4: serpin family
   108518939 (SERPINE1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108518939 (SERPINE1)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   108518939 (SERPINE1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 108518939
NCBI-ProteinID: XP_017713161
UniProt: A0A2K6JM29
LinkDB
Position
Un
AA seq 402 aa
MQMSPALACLVLGLAFVFGEGSTVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPY
GVASVLAMLQLTTGGETRQQIQAAMGFKIDDKGMAPALRHLYKELLGPWNKDEISTTDAI
FVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEAERARFIINDWVKTHTKGMISDLLGKGAV
DQLTRLVLVNALYFNGHWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPD
GHYYDILELPYHGNTLSMFIAAPYEKQVPLSALTNILSAQLISHWKGNMTRLPRLLVLPK
FSLETEVDLRKPLENLGMTDMFRQFQADFTSLSNQEPLHVAQALQKVKIEVNESGTVASS
STAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtctccagccctcgcctgcctagtcctgggcctggccttcgtctttggtgaa
gggtccaccgtgcaccatcccccatcctacgtggcccacctggcctcagacttcggggtt
agggtgtttcagcaggtggcgcaggcctccaaagaccgcaatgtggttttctcgccctat
ggggtggcctcggtgttggccatgctccagctgacaacgggaggagaaacccggcagcag
atccaagcggccatgggattcaagattgatgacaagggcatggctcctgccctccggcat
ctgtataaggagctcttggggccgtggaataaggatgagatcagcaccacagacgcgatc
ttcgtccagcgagatctgaagctggtccagggcttcatgccccacttcttcaggctgttc
cggagtacagtcaagcaggtggacttttcagaggcggagagagccagattcatcatcaac
gactgggtgaagacacacacaaaaggtatgatcagcgacttgcttgggaaaggagccgtg
gaccagctgacacggctggtgctggtgaatgccctctacttcaacggccactggaagacc
cccttccccgactccagcacccaccgccgcctcttccacaaatcagatggcagcaccgtc
tctgtgcccatgatggctcagaccaacaagttcaactatactgagttcaccacgcctgat
ggccattactacgacatcctggaactgccctaccacgggaacaccctcagcatgttcatt
gctgccccttatgaaaaacaggtgcctctctctgccctcaccaacattctgagtgcccag
ctgatcagccactggaaaggcaatatgaccaggctgccccgcctcctggttctgcccaag
ttctccctggagactgaagttgacctcaggaagcccctagagaacctgggaatgaccgac
atgttcagacaatttcaggcggacttcacgagtctttcaaaccaagagcctctccacgtt
gcgcaagcgctgcagaaagtgaagatcgaggtgaacgagagtggcacggtggcctcctca
tccacagctgtcatagtctcagcccggatggcccccgaggagatcatcatggacagaccc
ttcctctttgtggtccggcacaaccccacaggaacagtccttttcatgggccaagtgatg
gaaccctga

DBGET integrated database retrieval system