KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519632
Entry
108519632         CDS       T04641                                 

Gene name
GNAI3
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04360  Axon guidance
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04924  Renin secretion
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05030  Cocaine addiction
rbb05032  Morphine addiction
rbb05034  Alcoholism
rbb05133  Pertussis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05163  Human cytomegalovirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108519632 (GNAI3)
   04371 Apelin signaling pathway
    108519632 (GNAI3)
   04071 Sphingolipid signaling pathway
    108519632 (GNAI3)
   04024 cAMP signaling pathway
    108519632 (GNAI3)
   04022 cGMP-PKG signaling pathway
    108519632 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108519632 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108519632 (GNAI3)
   04670 Leukocyte transendothelial migration
    108519632 (GNAI3)
   04062 Chemokine signaling pathway
    108519632 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108519632 (GNAI3)
   04915 Estrogen signaling pathway
    108519632 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    108519632 (GNAI3)
   04921 Oxytocin signaling pathway
    108519632 (GNAI3)
   04926 Relaxin signaling pathway
    108519632 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    108519632 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    108519632 (GNAI3)
   04916 Melanogenesis
    108519632 (GNAI3)
   04924 Renin secretion
    108519632 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108519632 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    108519632 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108519632 (GNAI3)
   04727 GABAergic synapse
    108519632 (GNAI3)
   04725 Cholinergic synapse
    108519632 (GNAI3)
   04728 Dopaminergic synapse
    108519632 (GNAI3)
   04726 Serotonergic synapse
    108519632 (GNAI3)
   04730 Long-term depression
    108519632 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    108519632 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    108519632 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108519632 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108519632 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108519632 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    108519632 (GNAI3)
   05032 Morphine addiction
    108519632 (GNAI3)
   05034 Alcoholism
    108519632 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108519632 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108519632 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108519632 (GNAI3)
   05163 Human cytomegalovirus infection
    108519632 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108519632 (GNAI3)
   05142 Chagas disease
    108519632 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108519632 (GNAI3)
   04031 GTP-binding proteins [BR:rbb04031]
    108519632 (GNAI3)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108519632 (GNAI3)
GTP-binding proteins [BR:rbb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    108519632 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 108519632
NCBI-ProteinID: XP_017714260
UniProt: A0A2K6MY97
LinkDB
Position
Un
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggg
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccgacaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacacgagtgaag
accacaggcattgtagaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attattttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagagtacacaggttccaatacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526962
Entry
108526962         CDS       T04641                                 

Gene name
GNAI2
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04360  Axon guidance
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04924  Renin secretion
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05030  Cocaine addiction
rbb05032  Morphine addiction
rbb05034  Alcoholism
rbb05133  Pertussis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05163  Human cytomegalovirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108526962 (GNAI2)
   04371 Apelin signaling pathway
    108526962 (GNAI2)
   04071 Sphingolipid signaling pathway
    108526962 (GNAI2)
   04024 cAMP signaling pathway
    108526962 (GNAI2)
   04022 cGMP-PKG signaling pathway
    108526962 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108526962 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108526962 (GNAI2)
   04670 Leukocyte transendothelial migration
    108526962 (GNAI2)
   04062 Chemokine signaling pathway
    108526962 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108526962 (GNAI2)
   04915 Estrogen signaling pathway
    108526962 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    108526962 (GNAI2)
   04921 Oxytocin signaling pathway
    108526962 (GNAI2)
   04926 Relaxin signaling pathway
    108526962 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    108526962 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    108526962 (GNAI2)
   04916 Melanogenesis
    108526962 (GNAI2)
   04924 Renin secretion
    108526962 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108526962 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    108526962 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    108526962 (GNAI2)
   04727 GABAergic synapse
    108526962 (GNAI2)
   04725 Cholinergic synapse
    108526962 (GNAI2)
   04728 Dopaminergic synapse
    108526962 (GNAI2)
   04726 Serotonergic synapse
    108526962 (GNAI2)
   04730 Long-term depression
    108526962 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    108526962 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    108526962 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108526962 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526962 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108526962 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    108526962 (GNAI2)
   05032 Morphine addiction
    108526962 (GNAI2)
   05034 Alcoholism
    108526962 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108526962 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108526962 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108526962 (GNAI2)
   05163 Human cytomegalovirus infection
    108526962 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108526962 (GNAI2)
   05142 Chagas disease
    108526962 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108526962 (GNAI2)
   04031 GTP-binding proteins [BR:rbb04031]
    108526962 (GNAI2)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108526962 (GNAI2)
GTP-binding proteins [BR:rbb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    108526962 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 108526962
NCBI-ProteinID: XP_017723505
UniProt: A0A2K6M2U4
LinkDB
Position
Un
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggggagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggt
tactccgaggaggaatgccggcagtaccgggcggttgtttacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaaggcgtgctc
cccgatgacctgtccggcgtcatccggagactctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagccgcctactacctgaatgacctg
gagcgcattgcacagagtgactacatccccacgcagcaagatgtgttacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctatttgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaagagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaagtatgatgaagca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534866
Entry
108534866         CDS       T04641                                 

Gene name
GNAI1
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04360  Axon guidance
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04924  Renin secretion
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05030  Cocaine addiction
rbb05032  Morphine addiction
rbb05034  Alcoholism
rbb05133  Pertussis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05163  Human cytomegalovirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108534866 (GNAI1)
   04371 Apelin signaling pathway
    108534866 (GNAI1)
   04071 Sphingolipid signaling pathway
    108534866 (GNAI1)
   04024 cAMP signaling pathway
    108534866 (GNAI1)
   04022 cGMP-PKG signaling pathway
    108534866 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108534866 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108534866 (GNAI1)
   04670 Leukocyte transendothelial migration
    108534866 (GNAI1)
   04062 Chemokine signaling pathway
    108534866 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108534866 (GNAI1)
   04915 Estrogen signaling pathway
    108534866 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    108534866 (GNAI1)
   04921 Oxytocin signaling pathway
    108534866 (GNAI1)
   04926 Relaxin signaling pathway
    108534866 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    108534866 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    108534866 (GNAI1)
   04916 Melanogenesis
    108534866 (GNAI1)
   04924 Renin secretion
    108534866 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108534866 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    108534866 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    108534866 (GNAI1)
   04727 GABAergic synapse
    108534866 (GNAI1)
   04725 Cholinergic synapse
    108534866 (GNAI1)
   04728 Dopaminergic synapse
    108534866 (GNAI1)
   04726 Serotonergic synapse
    108534866 (GNAI1)
   04730 Long-term depression
    108534866 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    108534866 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    108534866 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108534866 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534866 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108534866 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    108534866 (GNAI1)
   05032 Morphine addiction
    108534866 (GNAI1)
   05034 Alcoholism
    108534866 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108534866 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108534866 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108534866 (GNAI1)
   05163 Human cytomegalovirus infection
    108534866 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108534866 (GNAI1)
   05142 Chagas disease
    108534866 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108534866 (GNAI1)
   04031 GTP-binding proteins [BR:rbb04031]
    108534866 (GNAI1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108534866 (GNAI1)
GTP-binding proteins [BR:rbb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    108534866 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF5435 AAA_29
Other DBs
NCBI-GeneID: 108534866
NCBI-ProteinID: XP_017735910
LinkDB
Position
Un
AA seq 421 aa
MLKRPELAFFGNFGSSPTPTRRGRKWWGWRGPRREAFERPLRERKDSPVLGARTRARRER
RQALALGNMGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQ
MKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAG
AAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYIRNLDRIAQQITPDQQD
VXELEXKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLV
LAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGS
NTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGL
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgctcaaacgcccagaactggcttttttcggcaactttggcagctctcccacccccacc
cgaaggggcaggaagtggtgggggtggcgtggcccccgtcgggaggcgttcgaacgcccg
ctccgagagagaaaggattcccctgtgcttggagcccgcactcgggcgcggagggagcgg
cggcaggctctcgctctcggcaacatgggctgcacgctgagcgccgaggacaaggcggcg
gtggagcggagtaagatgatcgaccgcaacctccgcgaggacggcgagaaggcggcgcgc
gaggtcaagctgctgctgcttggtgctggtgaatctggtaaaagtacaattgtgaagcag
atgaaaattatccatgaagctggttattcagaagaggagtgtaaacagtacaaagcagtc
gtctacagtaacaccatccagtcgattattgctatcattagggccatggggaggttgaag
atagactttggtgactcagcccgggcggatgatgcacgccaactctttgtgctagctgga
gctgctgaagaaggctttatgactgcagaacttgctggagttataaagagattgtggaaa
gatagtggtgtacaagcctgtttcaacagatcccgagagtaccagcttaatgattctgca
gcgtattatataagaaatttggacagaatagctcagcaaattacacccgaccaacaagat
gttncagaactagagtgaaaaactacaggaattgttgaaacccattttactttcaaagat
cttcattttaaaatgtttgatgtgggaggtcagagatctgagcggaagaagtggattcat
tgcttcgaaggagtgacggcgatcatcttctgtgtagcactgagtgactacgacctggtt
ctagctgaagatgaagaaatgaatcgaatgcatgaaagcatgaagttgtttgacagcata
tgtaacaacaagtggtttacagatacatccattatactttttctgaacaagaaggatctc
tttgaagaaaaaatcaagaagagccctctcactatatgctatccagaatatgcaggatca
aacacatatgaagaggcagctgcatatattcaatgtcagtttgaagacctcaataaaaga
aaggacacaaaggaaatatacacccacttcacatgtgccacagatactaagaatgtgcag
tttgtttttgatgctgtaacagatgtcatcataaaaaataatctaaaagattgtggtctc
ttctaa

DBGET integrated database retrieval system