KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519636
Entry
108519636         CDS       T04641                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04210  Apoptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04931  Insulin resistance
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108519636 (NFKBIA)
   04668 TNF signaling pathway
    108519636 (NFKBIA)
   04024 cAMP signaling pathway
    108519636 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108519636 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108519636 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    108519636 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    108519636 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    108519636 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    108519636 (NFKBIA)
   04660 T cell receptor signaling pathway
    108519636 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    108519636 (NFKBIA)
   04659 Th17 cell differentiation
    108519636 (NFKBIA)
   04657 IL-17 signaling pathway
    108519636 (NFKBIA)
   04662 B cell receptor signaling pathway
    108519636 (NFKBIA)
   04062 Chemokine signaling pathway
    108519636 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108519636 (NFKBIA)
   04926 Relaxin signaling pathway
    108519636 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108519636 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108519636 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108519636 (NFKBIA)
   05203 Viral carcinogenesis
    108519636 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108519636 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    108519636 (NFKBIA)
   05215 Prostate cancer
    108519636 (NFKBIA)
   05222 Small cell lung cancer
    108519636 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108519636 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108519636 (NFKBIA)
   05135 Yersinia infection
    108519636 (NFKBIA)
   05134 Legionellosis
    108519636 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519636 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    108519636 (NFKBIA)
   05161 Hepatitis B
    108519636 (NFKBIA)
   05160 Hepatitis C
    108519636 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    108519636 (NFKBIA)
   05164 Influenza A
    108519636 (NFKBIA)
   05162 Measles
    108519636 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    108519636 (NFKBIA)
   05163 Human cytomegalovirus infection
    108519636 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108519636 (NFKBIA)
   05169 Epstein-Barr virus infection
    108519636 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108519636 (NFKBIA)
   05140 Leishmaniasis
    108519636 (NFKBIA)
   05142 Chagas disease
    108519636 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108519636 (NFKBIA)
   04131 Membrane trafficking [BR:rbb04131]
    108519636 (NFKBIA)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    108519636 (NFKBIA)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    108519636 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 108519636
NCBI-ProteinID: XP_017714267
UniProt: A0A2K6MU18
LinkDB
Position
Un
AA seq 317 aa
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTLHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggtccccgcgacgggctg
aagaaggagcgactgctggacgaccgccacgacagcggcctggactccatgaaggatgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgtttctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccatttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcttggccagcgtg
ggagtcctgactcagtcctgcaccaccctgcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctgcacctagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc
cttcacctcgcagtagacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacgctggaaaaccttcagatgctg
ccggagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag
gatgagctgccctatgatgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system