KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519825
Entry
108519825         CDS       T04641                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04072  Phospholipase D signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04919  Thyroid hormone signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05135  Yersinia infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108519825 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108519825 (PLCG1)
   04014 Ras signaling pathway
    108519825 (PLCG1)
   04015 Rap1 signaling pathway
    108519825 (PLCG1)
   04370 VEGF signaling pathway
    108519825 (PLCG1)
   04064 NF-kappa B signaling pathway
    108519825 (PLCG1)
   04066 HIF-1 signaling pathway
    108519825 (PLCG1)
   04020 Calcium signaling pathway
    108519825 (PLCG1)
   04070 Phosphatidylinositol signaling system
    108519825 (PLCG1)
   04072 Phospholipase D signaling pathway
    108519825 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108519825 (PLCG1)
   04660 T cell receptor signaling pathway
    108519825 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    108519825 (PLCG1)
   04659 Th17 cell differentiation
    108519825 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    108519825 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    108519825 (PLCG1)
   04670 Leukocyte transendothelial migration
    108519825 (PLCG1)
   04062 Chemokine signaling pathway
    108519825 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108519825 (PLCG1)
   04919 Thyroid hormone signaling pathway
    108519825 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108519825 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108519825 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    108519825 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108519825 (PLCG1)
   05206 MicroRNAs in cancer
    108519825 (PLCG1)
   05205 Proteoglycans in cancer
    108519825 (PLCG1)
   05231 Choline metabolism in cancer
    108519825 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108519825 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108519825 (PLCG1)
   05214 Glioma
    108519825 (PLCG1)
   05223 Non-small cell lung cancer
    108519825 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108519825 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    108519825 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108519825 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108519825 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108519825 (PLCG1)
   05171 Coronavirus disease - COVID-19
    108519825 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108519825 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108519825 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108519825 (PLCG1)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108519825 (PLCG1)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108519825 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108519825 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 108519825
NCBI-ProteinID: XP_017714565
UniProt: A0A2K6MSB3
LinkDB
Position
Un
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLQTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatagagggggccattgatattcgtgaaatcaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggaccccgctttccgg
ccggaccagtcacactgctttgtcattctctatggaatggaattccgcctgaagacactg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatactttgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctaaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaatagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccccctttcccactattggatctcttcctcacacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccagatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcaaaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccagcacttcaagaaggtgctaggggacacactcctcaccaag
cccgtggagatctccgctgatgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggcggagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactacttcgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcggcacatcgctgagcgcctgctcactgagtactgcatcgagaccggggcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaatgggaaagtccagcactgccgtatccactcacggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacacactaccag
caggtgcctctgcgctgcaatgagtttgagatgcgactttcagagcctgtcccacagacc
aatgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctgatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgaaggcaagatcaagcattgccgtgtccagcaagag
ggccagactgtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaagcacccgctataccgcaagatgaaactgcgctatcccatcaacgaggaggcg
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagctctcttt
gactacaaggcccagagggaggatgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccagagagggag
cacttggacgagaacagccccctaggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagaccgcagatgccaggctcactgaaggg
aagataatggaacggaggaagaagatcgccctggagctctctgaacttgttgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagctggtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggctctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctgttgaggtgctgggtgcccgacatttg
ccaaagaatggccgaggcattgtgtgcccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccggccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccggta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgac
ctcagtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctg
tttcacggccgagcccgggaaggctcctttgaatcccgctaccagcagccatttgaggac
ttccgcatctcccaggagcatcttgcagaccattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaatggagacaaccgcctctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539491
Entry
108539491         CDS       T04641                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04020  Calcium signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04072  Phospholipase D signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04611  Platelet activation
rbb04625  C-type lectin receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04919  Thyroid hormone signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108539491 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108539491 (PLCG2)
   04014 Ras signaling pathway
    108539491 (PLCG2)
   04370 VEGF signaling pathway
    108539491 (PLCG2)
   04064 NF-kappa B signaling pathway
    108539491 (PLCG2)
   04066 HIF-1 signaling pathway
    108539491 (PLCG2)
   04020 Calcium signaling pathway
    108539491 (PLCG2)
   04070 Phosphatidylinositol signaling system
    108539491 (PLCG2)
   04072 Phospholipase D signaling pathway
    108539491 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108539491 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    108539491 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    108539491 (PLCG2)
   04662 B cell receptor signaling pathway
    108539491 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    108539491 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    108539491 (PLCG2)
   04670 Leukocyte transendothelial migration
    108539491 (PLCG2)
   04062 Chemokine signaling pathway
    108539491 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108539491 (PLCG2)
   04919 Thyroid hormone signaling pathway
    108539491 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108539491 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108539491 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    108539491 (PLCG2)
   04380 Osteoclast differentiation
    108539491 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539491 (PLCG2)
   05206 MicroRNAs in cancer
    108539491 (PLCG2)
   05205 Proteoglycans in cancer
    108539491 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108539491 (PLCG2)
   05214 Glioma
    108539491 (PLCG2)
   05223 Non-small cell lung cancer
    108539491 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108539491 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539491 (PLCG2)
   05171 Coronavirus disease - COVID-19
    108539491 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539491 (PLCG2)
   05169 Epstein-Barr virus infection
    108539491 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108539491 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539491 (PLCG2)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108539491 (PLCG2)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108539491 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108539491 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 108539491
NCBI-ProteinID: XP_017743707
UniProt: A0A2K6KPP6
LinkDB
Position
Un
AA seq 1265 aa
MSTMVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAL
NWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLSKVRERMTKFIDDTMRETAEPFLFVDEFLMYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKEHAFVTSSFPVILSIEEHCSVEQQRHMAKT
FKEVFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEQKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTTEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTTEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYESLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSISRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKF
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGADYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgtccaccatggtcaatgtggattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtccacccctgagcgg
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagaccgctgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gattttgaacgtgcaaaagcagttcgccagaaagaagattgctgcttcaccatcctgtat
ggcactcagttcgtcctcagcacactcagcttggcagctgactctaaagaagacgcactt
aattggctctctggcttgaaaatcttacaccaagaagcgatgagtgcgtccacacccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagtctccgagagttgaagaccatcttgcccctgatcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgagcagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtccgtgttcatcctggggaacactgacaggccggatgcctccgct
gtttacctgcatgacttccagaggtttctcatacatgaacagcaggagcattgggctcag
gatttgagcaaagtccgtgagcggatgacaaagttcatcgatgacaccatgcgtgaaact
gctgagcctttcttgtttgtggatgagttcctcatgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtctcat
tattggatctcctcgtcacataacacgtacctcacaggtgaccagctgcggagcgagtcg
tccccggaagcttacatccgctgcctgcgcatgggctgtcgctgcattgaactggactgc
tgggacgggcctgatgggaagccggtcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtacaggccatcaaagaacacgcctttgttacctcaagcttccca
gtgatcctgtccatcgaggagcactgcagcgtggagcagcagcgtcacatggccaagacc
ttcaaggaagtgtttggcgacctgctgctgatgaagcccacggaggccagcgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcacaagaagctgggtccc
cgaggcgacgtggatgtcaacgtggaggacaagaaggatgagcagaagcaacagggagag
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgcgccattgccgac
gccaagctgtccttcagtgatgacattgaacagactacggaggaagaagtgccccaggat
ataccccctacagagctacactttggggagaaatggttccacaagaaggtggagaagagg
acgagtgccgagaagttgctgcaggaatactgcatggagacagggggcaaggacggcacc
ttcctggttcgggagagcgagaccttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgttccaccacggagggtggaaccctgaagtactac
ctgactgacaacctcaccttcagcagcatctacgccctcatccagcactaccgcgagacg
cacctgcgctgcgccgagtttgagttgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgagagcctgagccgcggagaggcagaggacatgctg
atgaggatcccccgggacggagccttcctgatcaggaagcgagagggaagcgactcctat
gccatcaccttcagggctaggggcaaggtgaagcattgtcgcatcaaccgggatggccgg
cactttgtgctggggacctctgcctattttgagagtctggtggagctcgtcagttactac
gagaagcattcactctaccgaaagatgagactgcgctatcccgtgacccccgagctcctg
gagcgctacaacatggaaagagatataaactccctctacgatgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcaaagcgatgagctgagcttctgccgcggtgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccaggatccagcagtacttccca
tccaactacgtcgaggacatctcaactgcagatgttgaggagctggaaaaacagattatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaacacctataacgtt
gtgaaagccccacagggaaaaaaccagaagccctttgtctttatcctggagcccaagaag
cagggcgaccctccggtggagtttgccacagacagggtggaggagctcttcgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgatctggtggtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcatcagcaggcagaagcccgtcgacctcctgaggtacaatcaaaag
ggcctgacccgcgtctacccaaagggacaaagagttgactcttcaaactacgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacggcagataagttc
atgcagatgaatcacgcgctgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccaatgccacccgagtcccagaggaagatcctg
atgacactgacggtcaaggttctcggtgctcgccatctccccaaacttggacgaagtatt
gcctgtccctttgtagaggtagagatctgtggcgccgactatgacaacaacaagttcaag
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgctttgtggtttacgaagaagat
atgttcagtgatcccaactttcttgctcatgccacttaccccattaaagcaatcaaatca
ggattcaggtctgttcctctgaagaatgggtacagcgaggacatagagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctaaggaggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcaatgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcatag

DBGET integrated database retrieval system