KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519898
Entry
108519898         CDS       T04641                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04022  cGMP-PKG signaling pathway
rbb04141  Protein processing in endoplasmic reticulum
rbb04151  PI3K-Akt signaling pathway
rbb04211  Longevity regulating pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04668  TNF signaling pathway
rbb04728  Dopaminergic synapse
rbb04911  Insulin secretion
rbb04915  Estrogen signaling pathway
rbb04918  Thyroid hormone synthesis
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb05020  Prion disease
rbb05030  Cocaine addiction
rbb05031  Amphetamine addiction
rbb05034  Alcoholism
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108519898 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    108519898 (ATF6B)
   04022 cGMP-PKG signaling pathway
    108519898 (ATF6B)
   04151 PI3K-Akt signaling pathway
    108519898 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108519898 (ATF6B)
   04915 Estrogen signaling pathway
    108519898 (ATF6B)
   04926 Relaxin signaling pathway
    108519898 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    108519898 (ATF6B)
   04918 Thyroid hormone synthesis
    108519898 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    108519898 (ATF6B)
   04925 Aldosterone synthesis and secretion
    108519898 (ATF6B)
   04927 Cortisol synthesis and secretion
    108519898 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108519898 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    108519898 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    108519898 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    108519898 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    108519898 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    108519898 (ATF6B)
   05031 Amphetamine addiction
    108519898 (ATF6B)
   05034 Alcoholism
    108519898 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108519898 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108519898 (ATF6B)
   05161 Hepatitis B
    108519898 (ATF6B)
   05163 Human cytomegalovirus infection
    108519898 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108519898 (ATF6B)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108519898 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 108519898
NCBI-ProteinID: XP_017714673
LinkDB
Position
Un
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGA
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAACLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKVGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDAVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHPPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctgagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgtagtc
cccacctctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctgtgggat
gtcccagccccctcacttggagccgtccagatcagcatgggcccatcccctgatggcgcc
tcagggaaagccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctc
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgcctgtctaccgcggcctgagaggaagagcatcgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaaggtagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcccgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacagccttccccgggggcaccaaggagctactactgagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgatgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtt
cccatccaaccccctggacccccagaaagggatgctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaagcagccctcccca
accccaggcaatgccacaggcggccccttgccagcctctgcagccagccaggcccatcag
gcctcccacccgcccctctacctcaatcatccctga

DBGET integrated database retrieval system