KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520255
Entry
108520255         CDS       T04641                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04061  Viral protein interaction with cytokine and cytokine receptor
rbb04064  NF-kappa B signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04150  mTOR signaling pathway
rbb04210  Apoptosis
rbb04217  Necroptosis
rbb04350  TGF-beta signaling pathway
rbb04380  Osteoclast differentiation
rbb04612  Antigen processing and presentation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04657  IL-17 signaling pathway
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04940  Type I diabetes mellitus
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05310  Asthma
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05410  Hypertrophic cardiomyopathy
rbb05414  Dilated cardiomyopathy
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108520255 (TNF)
   04350 TGF-beta signaling pathway
    108520255 (TNF)
   04064 NF-kappa B signaling pathway
    108520255 (TNF)
   04668 TNF signaling pathway
    108520255 (TNF)
   04071 Sphingolipid signaling pathway
    108520255 (TNF)
   04150 mTOR signaling pathway
    108520255 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108520255 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108520255 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108520255 (TNF)
   04217 Necroptosis
    108520255 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108520255 (TNF)
   04620 Toll-like receptor signaling pathway
    108520255 (TNF)
   04621 NOD-like receptor signaling pathway
    108520255 (TNF)
   04622 RIG-I-like receptor signaling pathway
    108520255 (TNF)
   04625 C-type lectin receptor signaling pathway
    108520255 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    108520255 (TNF)
   04612 Antigen processing and presentation
    108520255 (TNF)
   04660 T cell receptor signaling pathway
    108520255 (TNF)
   04657 IL-17 signaling pathway
    108520255 (TNF)
   04664 Fc epsilon RI signaling pathway
    108520255 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108520255 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108520255 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108520255 (TNF)
  09163 Immune disease
   05310 Asthma
    108520255 (TNF)
   05322 Systemic lupus erythematosus
    108520255 (TNF)
   05323 Rheumatoid arthritis
    108520255 (TNF)
   05321 Inflammatory bowel disease
    108520255 (TNF)
   05330 Allograft rejection
    108520255 (TNF)
   05332 Graft-versus-host disease
    108520255 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108520255 (TNF)
   05014 Amyotrophic lateral sclerosis
    108520255 (TNF)
   05020 Prion disease
    108520255 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    108520255 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108520255 (TNF)
   05410 Hypertrophic cardiomyopathy
    108520255 (TNF)
   05414 Dilated cardiomyopathy
    108520255 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108520255 (TNF)
   04940 Type I diabetes mellitus
    108520255 (TNF)
   04932 Non-alcoholic fatty liver disease
    108520255 (TNF)
   04931 Insulin resistance
    108520255 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108520255 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108520255 (TNF)
   05135 Yersinia infection
    108520255 (TNF)
   05133 Pertussis
    108520255 (TNF)
   05134 Legionellosis
    108520255 (TNF)
   05152 Tuberculosis
    108520255 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108520255 (TNF)
   05170 Human immunodeficiency virus 1 infection
    108520255 (TNF)
   05161 Hepatitis B
    108520255 (TNF)
   05160 Hepatitis C
    108520255 (TNF)
   05171 Coronavirus disease - COVID-19
    108520255 (TNF)
   05164 Influenza A
    108520255 (TNF)
   05168 Herpes simplex virus 1 infection
    108520255 (TNF)
   05163 Human cytomegalovirus infection
    108520255 (TNF)
   05169 Epstein-Barr virus infection
    108520255 (TNF)
   05165 Human papillomavirus infection
    108520255 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108520255 (TNF)
   05144 Malaria
    108520255 (TNF)
   05145 Toxoplasmosis
    108520255 (TNF)
   05140 Leishmaniasis
    108520255 (TNF)
   05142 Chagas disease
    108520255 (TNF)
   05143 African trypanosomiasis
    108520255 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108520255 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108520255 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108520255 (TNF)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Tumor necrosis fators
   108520255 (TNF)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108520255 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 108520255
NCBI-ProteinID: XP_017715043
LinkDB
Position
Un
AA seq 234 aa
MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQFPKDLPLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVEL
TDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQR
ETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcacggaaagcatgatccgggacgtggagctggccgaggaggcactccccaggaag
acagcggggccccagggctccaggcggtgctggtttctcagcctcttctccttcctgctc
gtggcaggcgccaccacgctcttctgtctgctgcactttggagtgatcggcccccagagg
gaagagcagttccccaaggacctccctctaatcagccctctggcccaggcagtcagatca
tcttctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaatcctcaagctgag
gggcagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtagagctg
acagataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctc
ttcaagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagccgcatc
gccgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagg
gagactccagagggggctgaggccaagccctggtatgagcccatctacctaggaggggtc
ttccagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactatctcgac
tttgccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system