KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520341Help
Entry
108520341         CDS       T04641                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rbb01002]
    108520341 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rbb03110]
    108520341 (PCSK1)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108520341 (PCSK1)
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S8: subtilisin family
   108520341 (PCSK1)
Chaperones and folding catalysts [BR:rbb03110]
 Intramolecular chaperones
  Subtilisin family
   108520341 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N OmpA_membrane
Motif
Other DBs
NCBI-GeneID: 108520341
NCBI-ProteinID: XP_017715173
UniProt: A0A2K6K9A4
LinkDB All DBs
Position
Un
AA seq 749 aa AA seqDB search
MERRAWTLQCTAFALFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKSHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERAKRSAVKDSAQNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDSEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTKACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENTLVSKSPSSSSVGGRRDELEEGAPS
EAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDY
VDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgcactgctttcgccctcttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaaggcaatttgttaatgaatgggcagcggagatcccc
gggggcccggaagcagcctcggccatcgccgaggagctgggttatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaagccaccccagaaggtctcga
aggagtgcctttcacatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagagctaaacgttcagctgtaaaggactcagcacaaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacggcagcc
ctgcccaagctggaccttcatgtgatacctgtttggcaaaaaggcattacaggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgattcagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgtggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaagccagttcaattggattcaatcctggacac
gtggatatttatagtgcaagctggggccctaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacaggggagacaggggaagggg
tccatcttcgtctgggcttcgggaaacggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcccagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggggattac
accgaccagagaatcacgagtgctgacctgcacaatgactgcacggagacgcacacgggc
acctctgcctctgcacctctggctgctggcatcttcgctttggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgatccgctg
gccaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcggtttgga
tttggcttgctaaatgccaaagctctggtggatttagctgatcccaggacttggaggagt
gtgcctgagaagaaagagtgtgttgtaaaggacaacgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaaaagcttgtgaaggacaagaaaatgcc
atcaagtccctggagcatgtgcaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctgttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcatacatgggga
gagaaccctataggtacttggactttgagaattacagatatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcatgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacaccgttcagaatgacagaagaggggtg
gagaagatggtggatccgggggaggagcagcccacacaagagaacaccctggtgtccaaa
agccctagcagcagcagcgtcgggggccggagggatgagctggaggagggagccccttcc
gaggccatgctgcgactcctacaaagtgctttcagtaaaaactcgccgccaaagcaatca
ccaaagaagtccccaagtgcaaagctcaacatcccttatgaaaacttctatgaagccctg
gaaaagctgaacaaaccttcccagcttaaagactctgaagacagtctctataatgactat
gttgatgttttttataacactaaaccttacaagcacagagatgaccggctgcttcaagct
ctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system