KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520444
Entry
108520444         CDS       T04641                                 

Definition
(RefSeq) cytochrome b-245 light chain
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04621  NOD-like receptor signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb05020  Prion disease
rbb05140  Leishmaniasis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108520444
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108520444
   04670 Leukocyte transendothelial migration
    108520444
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108520444
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    108520444
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108520444
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108520444
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108520444
Membrane trafficking [BR:rbb04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108520444
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P DUF308
Other DBs
NCBI-GeneID: 108520444
NCBI-ProteinID: XP_017715312
UniProt: A0A2K6KJZ2
LinkDB
Position
Un
AA seq 194 aa
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTSVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPTNPPPRPPAEARKKPSDEEAAAAGGPPG
GPQANPIPVTDEVV
NT seq 585 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctggccgcttcacccagtggtacttcggcgcc
tactccatcgtggcgggcgtgtttgtctgcctgctggagtatccccgggggaagaggaag
aagggctccaccatggagcgctggggccagaagtacatgacctccgtggtgaagctgttc
gggcccctcaccaggaattattacgttcgggctgtcctgcacctcttgctctcggtgccc
gccggcttcctgctggccaccatcctcgggactgcctgcctggccatcgcgagcggcatc
tacctgttggcggccgtgcgtggtgagcagtggacaccgatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccaccaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgacgaggaggcggcggcggcggggggacccccggga
ggtccccaggccaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system