KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520466
Entry
108520466         CDS       T04641                                 

Gene name
TAB1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04668  TNF signaling pathway
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05161  Hepatitis B
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108520466 (TAB1)
   04064 NF-kappa B signaling pathway
    108520466 (TAB1)
   04668 TNF signaling pathway
    108520466 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108520466 (TAB1)
   04621 NOD-like receptor signaling pathway
    108520466 (TAB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108520466 (TAB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108520466 (TAB1)
   05135 Yersinia infection
    108520466 (TAB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108520466 (TAB1)
   05161 Hepatitis B
    108520466 (TAB1)
   05168 Herpes simplex virus 1 infection
    108520466 (TAB1)
   05169 Epstein-Barr virus infection
    108520466 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108520466 (TAB1)
   05140 Leishmaniasis
    108520466 (TAB1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 108520466
NCBI-ProteinID: XP_017715337
UniProt: A0A2K6K2J6
LinkDB
Position
Un
AA seq 504 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQNVVTAP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctgcagagtgagcagcagccaagctggacagatgac
ctgccactctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctaaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctacgatggcaaccgggtgaccaactttgtg
gcccagcggctgtccgcagagctcctactgggccagctgaatgccgagcatgccgaggcc
gatgtgcggcgcgtgctgctgcaggccttcgatgtggtagagaggagcttcctggagtcc
attgatgatgccttggctgagaaggcaagcctccagtcgcaattgccagagggggtgcct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgctggagagg
gaaatttcaggaggggccatggccgttgtggcggtccttctcaacaataagctctatgtc
gccaatgttggtacaaaccgtgcacttttatgcaaatcaacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgcctttcgcag
ctgggcttggacgccgggaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggtcaaatatggctacacggacattgaccttctcagtgcc
gccaagtccaaaccaatcatcgcagagccagaaatccacggggcacagccactggatggg
gtgacaggcttcctggtgctgatgtcagaggggctctacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggaaattgctgcaatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtggtggaccgggtaaagcgcatccacagcgac
accttcgccagcggtggggagcgtgccaggttctgcccccggcatgaggacatgaccctg
ctggtgaggaactttggctacccactgggtgaaatgagccagcccacaccgagcccggcc
ccagctgcagggggacgagtgtaccctgtgtctgtgccatactccagtgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagcgcttccaccctggatgaagccaccccgaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctccgacgggggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggatggccgtgttgagccc
tacgtggactttgctgagttttatcgcctctggagcgtggaccatggcgagcagaacgtg
gtgacggcaccatag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536673
Entry
108536673         CDS       T04641                                 

Gene name
TAB2
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04668  TNF signaling pathway
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108536673 (TAB2)
   04064 NF-kappa B signaling pathway
    108536673 (TAB2)
   04668 TNF signaling pathway
    108536673 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108536673 (TAB2)
   04621 NOD-like receptor signaling pathway
    108536673 (TAB2)
   04657 IL-17 signaling pathway
    108536673 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108536673 (TAB2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108536673 (TAB2)
   05135 Yersinia infection
    108536673 (TAB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108536673 (TAB2)
   05161 Hepatitis B
    108536673 (TAB2)
   05171 Coronavirus disease - COVID-19
    108536673 (TAB2)
   05162 Measles
    108536673 (TAB2)
   05168 Herpes simplex virus 1 infection
    108536673 (TAB2)
   05169 Epstein-Barr virus infection
    108536673 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108536673 (TAB2)
   05140 Leishmaniasis
    108536673 (TAB2)
SSDB
Motif
Pfam: CUE zf-RanBP DivIC
Other DBs
NCBI-GeneID: 108536673
NCBI-ProteinID: XP_017739155
UniProt: A0A2K6KMP3
LinkDB
Position
Un
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANATTGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcttctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcaaccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcagggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccacccaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaacagccaaacttta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagctaatgccaccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatccacccaaaagt
cgagcaataggcaataactctgcaacttctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtttctcccaataaaccccctgcagtttcaccaggggta
gtgtcccctacctttgaacttacaaatcttctaaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacgttagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgacgatgctgcctacacacaagctctgttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccaaataccttccctcgaagaaatgcagcagttgagaagttgtaataga
caactccagattgacattgactgcctaaccaaagaaattgatctttttcaagcccgagga
ccacattttaatcccagtgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtactgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgcccaggcatttctga

DBGET integrated database retrieval system