KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521460
Entry
108521460         CDS       T04641                                 

Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04310  Wnt signaling pathway
rbb04340  Hedgehog signaling pathway
rbb04390  Hippo signaling pathway
rbb04392  Hippo signaling pathway - multiple species
rbb04710  Circadian rhythm
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108521460
   04340 Hedgehog signaling pathway
    108521460
   04390 Hippo signaling pathway
    108521460
   04392 Hippo signaling pathway - multiple species
    108521460
   04068 FoxO signaling pathway
    108521460
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    108521460
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108521460
   05022 Pathways of neurodegeneration - multiple diseases
    108521460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108521460
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108521460
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108521460
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   108521460
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108521460
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 108521460
NCBI-ProteinID: XP_017716793
UniProt: A0A2K6MKG4
LinkDB
Position
Un
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagattgggagcgggtccttc
ggagatatctacttgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacgaagcacccccagctgcacattgagagcaagttctacaagatgatgcag
ggcggcgtggggatcccttccatcaagtggtgtggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcccagcctcgaggacctgttcaacttctgttcccgcaagttc
agcctgaagacggtgctgctcctggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatgggtctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggctcgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcagggactcaaagcagccacc
aagcgccagaagtatgagcggatcagcgagaagaagatgtcaacgcccattgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgccagctcttccgcaacctcttccaccggcag
ggcttctcctatgactatgtcttcgactggaacatgctgaaattcggtgcagcccggaac
cccgaggacgtggaccgggagcggcgagaacacgagcgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccagctggc
aatacttctcccagagcgatctcacgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggcgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatcttgggaagtga

DBGET integrated database retrieval system