KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521961
Entry
108521961         CDS       T04641                                 

Gene name
NR1H3
Definition
(RefSeq) nuclear receptor subfamily 1 group H member 3
  KO
K08536  liver X receptor alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03320  PPAR signaling pathway
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108521961 (NR1H3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    108521961 (NR1H3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108521961 (NR1H3)
   04931 Insulin resistance
    108521961 (NR1H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108521961 (NR1H3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rbb03310]
    108521961 (NR1H3)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    108521961 (NR1H3)
Nuclear receptors [BR:rbb03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   108521961 (NR1H3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108521961
NCBI-ProteinID: XP_017717502
LinkDB
Position
Un
AA seq 447 aa
MSVWLGAPVPDIPPDSAAELWKPGAQDASSQTQGGNSCILREEARMPHSARGTAGVGLEA
AEPTVLLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHTVCLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccgtgtggctgggggcccctgtgcctgacattcctcctgactctgcagcggagctg
tggaagccaggtgcacaggatgcaagcagccagacccagggaggcaacagctgcatcctc
agagaggaagccaggatgccccactctgccagaggcactgcaggggtggggctggaggct
gcagagcccacagtcctgctcaccagggcagagcccccttcagaacccacagagatccgt
ccacaaaagcggaaaaaggggccagcccccaaaatgctggggaacgagctatgcagcgtg
tgtggggacaaggcctccggcttccactacaatgttctgagctgcgagggttgcaaggga
ttcttccgccgcagcgtcatcaagggagcgcgctacatctgccacagtggcggccactgc
cccatggacacctacatgcgtcgcaagtgccaggagtgtcggcttcgcaagtgccgccag
gctggcatgcgggaggagtgtgtcctgtcagaagaacagatccgtctgaagaaactgaag
cggcaagaggaggaacaggctcataccgtatgcctgccccccagggcttcctcaccccct
caaatcctgcctcagctcagcccggagcaactgggcatgatcgagaagctggtcgctgcc
cagcaacagtgtaaccggcgctccttttctgatcagcttcgagtcacgccttggcccatg
gcaccagatccccatagccgggaggcccgtcagcagcgctttgcccacttcactgagctg
gccatcgtctctgtgcaggagatagttgactttgctaaacagctacccggcttcctgcag
ctcagccgggaggaccagattgccctgctgaagacctctgcgatcgaggtgatgcttctg
gagacatctcggaggtacaaccctgggagtgagagtatcaccttcctcaaggatttcagt
tataaccgggaagactttgccaaagcagggctgcaagtggaattcatcaaccccatcttc
gagttctccagggccatgaatgagctgcaactcaatgatgctgagtttgctttgctcatt
gccatcagcatcttctctgcagaccggcccaatgtgcaggaccagctccaggtagagagg
ctgcagcacacatatgtggaagccctgcatgcctatgtctccatccaccatccccatgac
cgactgatgttcccacggatgctaatgaaactggtgagcctccggaccctgagcagcgtc
cactcagagcaagtgtttgcactgcgtctgcaggacaaaaagctcccaccgctgctctct
gagatctgggatgtgcacgaatga

DBGET integrated database retrieval system