KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521962
Entry
108521962         CDS       T04641                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03420  Nucleotide excision repair
rbb04115  p53 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05161  Hepatitis B
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108521962 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    108521962 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108521962 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108521962 (DDB2)
   05202 Transcriptional misregulation in cancer
    108521962 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108521962 (DDB2)
   05212 Pancreatic cancer
    108521962 (DDB2)
   05225 Hepatocellular carcinoma
    108521962 (DDB2)
   05226 Gastric cancer
    108521962 (DDB2)
   05214 Glioma
    108521962 (DDB2)
   05216 Thyroid cancer
    108521962 (DDB2)
   05220 Chronic myeloid leukemia
    108521962 (DDB2)
   05217 Basal cell carcinoma
    108521962 (DDB2)
   05218 Melanoma
    108521962 (DDB2)
   05213 Endometrial cancer
    108521962 (DDB2)
   05224 Breast cancer
    108521962 (DDB2)
   05222 Small cell lung cancer
    108521962 (DDB2)
   05223 Non-small cell lung cancer
    108521962 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108521962 (DDB2)
   05169 Epstein-Barr virus infection
    108521962 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108521962 (DDB2)
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108521962 (DDB2)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     108521962 (DDB2)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      108521962 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 108521962
NCBI-ProteinID: XP_017717515
UniProt: A0A2K6LLR9
LinkDB
Position
Un
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRGDSDCLWAGLAGL
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagaggtgactcagactgcctctgggcggggctggctggccta
cagatcctgccgccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgctccctttgacaggagggctacatccttggcgtggcac
ccgactcaccccagcactgtggctgtgggttccaaagggggagacatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtccgccagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggatggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgccacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgtcgtaggccgatacccagatcctaat
ttcaaaagttgtaccccctatgaattgaggacgatcgatgtgtttgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgctcaatgagttc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacccggaaatga

DBGET integrated database retrieval system